Oreochromis niloticus (Nile tilapia): 100699544 Help Entry 100699544         CDS       T06104                                  Symbol tmem258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism onl  Oreochromis niloticus (Nile tilapia) Pathway onl00510   N-Glycan biosynthesis onl00513   Various types of N-glycan biosynthesis onl04141   Protein processing in endoplasmic reticulum Module onl_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:onl00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     100699544 (tmem258)    00513 Various types of N-glycan biosynthesis     100699544 (tmem258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     100699544 (tmem258) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 TctB Motif Other DBs NCBI-GeneID:  100699544 NCBI-ProteinID:  XP_003440517 LinkDB All DBs Position LG7:51167266..51169420 Genome browser AA seq 79 aa AA seqDB search MELEAMTRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDVYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggaactcgaggccatgaccagatacaccagcccggtgaacccggctgtgttcccccac ctcactgtggtgctgctggctatcggcatgttcttcaccgcctggttcttcgtctatgag gtgacatcaacaaaatacacacgggatgtctacaaagagctgctgatctccctcgtggca tcacttttcatggggtttggtgtgctgttcctactactctgggttgggatatatgtatga

DBGET integrated database retrieval system