Oreochromis niloticus (Nile tilapia): 100708409 Help Entry 100708409         CDS       T06104                                  Symbol pole4 Name (RefSeq) DNA polymerase epsilon subunit 4   KO K03506   DNA polymerase epsilon subunit 4 [EC:2.7.7.7] Organism onl  Oreochromis niloticus (Nile tilapia) Pathway onl03030   DNA replication onl03410   Base excision repair onl03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:onl00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     100708409 (pole4)    03410 Base excision repair     100708409 (pole4)    03420 Nucleotide excision repair     100708409 (pole4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:onl03032]     100708409 (pole4)    03400 DNA repair and recombination proteins [BR:onl03400]     100708409 (pole4) Enzymes [BR:onl01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      100708409 (pole4) DNA replication proteins [BR:onl03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     100708409 (pole4) DNA repair and recombination proteins [BR:onl03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       100708409 (pole4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C TAF TFIID-31kDa Motif Other DBs NCBI-GeneID:  100708409 NCBI-ProteinID:  XP_003439700 Ensembl:  ENSONIG00000002352 UniProt:  I3J252 LinkDB All DBs Position LG23:41697053..41700364 Genome browser AA seq 128 aa AA seqDB search MAATVTTSLVTATEHDPDRCESEEETRGAEAEDSGQQQTGPVTVSHSRLSKLPLARIKAL MKTDPDVSLASQESVFIIAKATELFVEMIAKDALVYAQQGKRKTLQRKDLDNAIEAIDEF AFLEGTLD NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggcagcaacagtgacgacgagtcttgtgaccgcaacggagcacgaccctgaccggtgt gagagtgaggaggagacccgcggggccgaggcggaggacagcggccagcagcagacgggc ccagtcacggtgagccacagccggctgtccaaactcccgctggcccgcatcaaggctctg atgaagaccgacccagacgtgtccctcgccagccaggagtctgtgttcatcatcgctaaa gccacggagttgtttgttgagatgattgccaaagatgctctagtgtatgcacagcaaggg aagaggaaaactttgcaaagaaaagacttggacaatgcaatagaagccatagatgagttt gcatttctcgaaggcacactggattaa

DBGET integrated database retrieval system