Oreochromis niloticus (Nile tilapia): 100709445 Help Entry 100709445         CDS       T06104                                  Name (RefSeq) stromal cell-derived factor 1   KO K10031   C-X-C motif chemokine 12 Organism onl  Oreochromis niloticus (Nile tilapia) Pathway onl04060   Cytokine-cytokine receptor interaction onl04672   Intestinal immune network for IgA production onl04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:onl00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100709445  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100709445  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     100709445  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:onl04052]     100709445    00536 Glycosaminoglycan binding proteins [BR:onl00536]     100709445 Cytokines and neuropeptides [BR:onl04052]  Cytokines   Chemokines    100709445 Glycosaminoglycan binding proteins [BR:onl00536]  Heparan sulfate / Heparin   Chemokines    100709445 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  100709445 NCBI-ProteinID:  XP_003450047 Ensembl:  ENSONIG00000043161 UniProt:  A0A669D2I6 LinkDB All DBs Position LG6:30484944..30498409 Genome browser AA seq 102 aa AA seqDB search MDVKLMALLALLAVATHVPTSNAKPISLVERCWCRSTLNTVPQRSIKELKFLHTPNCPFQ VIAKLKSNREVCINPETKWLQQYLKNAINKVKKSRRRANKIN NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggacgtcaaactgatggcactgctggctctgttggccgtggccacacatgttccgacc tccaacgcaaagcccatcagtctggttgagcgctgctggtgtcgatccactctcaacacg gttccccagcgctccatcaaagagctcaagtttctccacacgcccaactgccccttccaa gtcattgcaaagctgaagagcaacagggaagtttgcatcaaccctgagaccaaatggctg cagcagtacttaaagaatgccattaacaaggtgaagaaatctagaagacgcgctaacaag atcaactaa

DBGET integrated database retrieval system