Orcinus orca (killer whale): 101275048 Help Entry 101275048         CDS       T05247                                  Symbol TMEM258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism oor  Orcinus orca (killer whale) Pathway oor00510   N-Glycan biosynthesis oor00513   Various types of N-glycan biosynthesis oor04141   Protein processing in endoplasmic reticulum Module oor_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:oor00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     101275048 (TMEM258)    00513 Various types of N-glycan biosynthesis     101275048 (TMEM258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     101275048 (TMEM258) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 TctB Phage_holin_3_3 Motif Other DBs NCBI-GeneID:  101275048 NCBI-ProteinID:  XP_004264243 LinkDB All DBs Position 8:9642609..9646089 Genome browser AA seq 79 aa AA seqDB search MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagcttgaggccatgagcagatacaccagtccagtgaacccggctgtctttccgcat ctgaccgtggtgctgttggccattggcatgttcttcaccgcctggttcttcgtttacgag gtcacctccaccaaatacactcgggatatctacaaagagctcctcatctctttggtggcc tcgctcttcatgggctttggagtgctcttcctgctgctctgggtcggcatctacgtgtga

DBGET integrated database retrieval system