Orcinus orca (killer whale): 101277437
Help
Entry
101277437 CDS
T05247
Symbol
NDUFB2
Name
(RefSeq) NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial
KO
K03958
NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 2
Organism
oor
Orcinus orca (killer whale)
Pathway
oor00190
Oxidative phosphorylation
oor01100
Metabolic pathways
oor04714
Thermogenesis
oor04723
Retrograde endocannabinoid signaling
oor04932
Non-alcoholic fatty liver disease
oor05010
Alzheimer disease
oor05012
Parkinson disease
oor05014
Amyotrophic lateral sclerosis
oor05016
Huntington disease
oor05020
Prion disease
oor05022
Pathways of neurodegeneration - multiple diseases
oor05208
Chemical carcinogenesis - reactive oxygen species
oor05415
Diabetic cardiomyopathy
Module
oor_M00147
NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:
oor00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
101277437 (NDUFB2)
09150 Organismal Systems
09156 Nervous system
04723 Retrograde endocannabinoid signaling
101277437 (NDUFB2)
09159 Environmental adaptation
04714 Thermogenesis
101277437 (NDUFB2)
09160 Human Diseases
09161 Cancer: overview
05208 Chemical carcinogenesis - reactive oxygen species
101277437 (NDUFB2)
09164 Neurodegenerative disease
05010 Alzheimer disease
101277437 (NDUFB2)
05012 Parkinson disease
101277437 (NDUFB2)
05014 Amyotrophic lateral sclerosis
101277437 (NDUFB2)
05016 Huntington disease
101277437 (NDUFB2)
05020 Prion disease
101277437 (NDUFB2)
05022 Pathways of neurodegeneration - multiple diseases
101277437 (NDUFB2)
09166 Cardiovascular disease
05415 Diabetic cardiomyopathy
101277437 (NDUFB2)
09167 Endocrine and metabolic disease
04932 Non-alcoholic fatty liver disease
101277437 (NDUFB2)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
NADH_B2
Motif
Other DBs
NCBI-GeneID:
101277437
NCBI-ProteinID:
XP_004272181
LinkDB
All DBs
Position
9:complement(13204178..13213501)
Genome browser
AA seq
105 aa
AA seq
DB search
MSALTRLAPLARVGGHFFRGLRARAAGGAGVRHAGGGVHIEPQYRQFPQLTRSQVIKAEF
FSATMWFWILWRFWHDSDAVLGHFPYPDPSQWTDEELGILPDDED
NT seq
318 nt
NT seq
+upstream
nt +downstream
nt
atgtcggctttgacgcgtctagcgcctttagcgcgcgttggaggccacttcttcaggggc
ctacgcgcgcgggcggctggaggcgctggagtccgtcatgctggtggaggtgtgcatatc
gagccccagtacaggcagtttccccagctgaccagatcccaggtgatcaaggcagagttc
ttcagtgcaaccatgtggttctggattctctggcgcttttggcatgactcagatgctgtg
ctgggtcactttccatatccagatccttctcagtggacggatgaagaattaggtatcctt
cctgatgatgaagactga
DBGET
integrated database retrieval system