Orcinus orca (killer whale): 101280803 Help Entry 101280803         CDS       T05247                                  Symbol FGF2 Name (RefSeq) fibroblast growth factor 2   KO K18497   fibroblast growth factor 2 Organism oor  Orcinus orca (killer whale) Pathway oor01521   EGFR tyrosine kinase inhibitor resistance oor04010   MAPK signaling pathway oor04014   Ras signaling pathway oor04015   Rap1 signaling pathway oor04020   Calcium signaling pathway oor04151   PI3K-Akt signaling pathway oor04550   Signaling pathways regulating pluripotency of stem cells oor04810   Regulation of actin cytoskeleton oor05167   Kaposi sarcoma-associated herpesvirus infection oor05200   Pathways in cancer oor05205   Proteoglycans in cancer oor05207   Chemical carcinogenesis - receptor activation oor05218   Melanoma oor05224   Breast cancer oor05226   Gastric cancer Brite KEGG Orthology (KO) [BR:oor00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101280803 (FGF2)    04014 Ras signaling pathway     101280803 (FGF2)    04015 Rap1 signaling pathway     101280803 (FGF2)    04020 Calcium signaling pathway     101280803 (FGF2)    04151 PI3K-Akt signaling pathway     101280803 (FGF2)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     101280803 (FGF2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     101280803 (FGF2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101280803 (FGF2)    05205 Proteoglycans in cancer     101280803 (FGF2)    05207 Chemical carcinogenesis - receptor activation     101280803 (FGF2)   09162 Cancer: specific types    05226 Gastric cancer     101280803 (FGF2)    05218 Melanoma     101280803 (FGF2)    05224 Breast cancer     101280803 (FGF2)   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     101280803 (FGF2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     101280803 (FGF2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oor04052]     101280803 (FGF2)    00536 Glycosaminoglycan binding proteins [BR:oor00536]     101280803 (FGF2) Cytokines and neuropeptides [BR:oor04052]  Cytokines   Growth factors (RTK binding)    101280803 (FGF2) Glycosaminoglycan binding proteins [BR:oor00536]  Heparan sulfate / Heparin   Growth factors/receptors    101280803 (FGF2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Fascin IL1 Motif Other DBs NCBI-GeneID:  101280803 NCBI-ProteinID:  XP_004265254 LinkDB All DBs Position 4:136138815..136197008 Genome browser AA seq 155 aa AA seqDB search MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHV KLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKY SSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atggcagccgggagcatcaccacgctgcccgccctgccggaggacggcggcagcggcgcc ttcccgcccggccacttcaaggaccccaagcggctgtactgcaaaaacgggggcttcttc ctgcgcatccaccccgacggccgagtggacggggtccgcgagaagagcgaccctcacgtc aaactacaacttcaagcagaagagagaggggttgtgtctatcaaaggagtgtgtgcgaac cgttaccttgctatgaaggaagatggaagattactggcttctaaatgtgttacagacgag tgtttcttttttgaacgattggaatctaataactacaatacttaccggtcaaggaaatac tccagttggtatgtggcactgaagcgaactgggcagtataaacttggacccaaaacagga cctgggcagaaggctatactttttcttccaatgtctgctaagagctga

DBGET integrated database retrieval system