KEGG   Orcinus orca (killer whale): 101282167
Entry
101282167         CDS       T05247                                 
Name
(RefSeq) NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial-like
  KO
K03958  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 2
Organism
oor  Orcinus orca (killer whale)
Pathway
oor00190  Oxidative phosphorylation
oor01100  Metabolic pathways
oor04714  Thermogenesis
oor04723  Retrograde endocannabinoid signaling
oor04932  Non-alcoholic fatty liver disease
oor05010  Alzheimer disease
oor05012  Parkinson disease
oor05014  Amyotrophic lateral sclerosis
oor05016  Huntington disease
oor05020  Prion disease
oor05022  Pathways of neurodegeneration - multiple diseases
oor05208  Chemical carcinogenesis - reactive oxygen species
oor05415  Diabetic cardiomyopathy
Module
oor_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:oor00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101282167
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101282167
  09159 Environmental adaptation
   04714 Thermogenesis
    101282167
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    101282167
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101282167
   05012 Parkinson disease
    101282167
   05014 Amyotrophic lateral sclerosis
    101282167
   05016 Huntington disease
    101282167
   05020 Prion disease
    101282167
   05022 Pathways of neurodegeneration - multiple diseases
    101282167
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    101282167
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101282167
SSDB
Motif
Pfam: NADH_B2
Other DBs
NCBI-GeneID: 101282167
NCBI-ProteinID: XP_033256009
LinkDB
Position
7:complement(9670911..9671302)
AA seq 129 aa
MSARTRQTPFPGVGGHFFRGCRARVAEGAGVRHAGGGVHIEPRYRLFPQLTRSQVIKVEF
FSAIMWFWILWRFWHDSDAVLGHFPYPDPSQWTDEELGILPDDETENVDSTLSKSQVRIS
RNYRRHIVY
NT seq 390 nt   +upstreamnt  +downstreamnt
atgtcggctcggacgcggcaaacgcctttcccgggcgttggaggccacttctttaggggc
tgccgcgcgcgggtggcagaaggcgctggagtccgtcatgctggtggaggtgtgcatatc
gagccccggtacagactgtttccccagctgaccagatcccaggtgatcaaggtggagttc
ttcagtgcaatcatgtggttctggattctctggcgattttggcatgactcagatgccgtg
ctgggtcactttccatatccagatccttcccaatggacggatgaagaattaggtatcctt
cctgatgatgagactgaaaatgtagactcaactctttccaagagccaggtgagaatttca
agaaattacagacgtcatattgtatattaa

DBGET integrated database retrieval system