Orcinus orca (killer whale): 101286650 Help Entry 101286650         CDS       T05247                                  Symbol FOS Name (RefSeq) protein c-Fos   KO K04379   proto-oncogene protein c-fos Organism oor  Orcinus orca (killer whale) Pathway oor01522   Endocrine resistance oor04010   MAPK signaling pathway oor04024   cAMP signaling pathway oor04210   Apoptosis oor04380   Osteoclast differentiation oor04620   Toll-like receptor signaling pathway oor04657   IL-17 signaling pathway oor04658   Th1 and Th2 cell differentiation oor04659   Th17 cell differentiation oor04660   T cell receptor signaling pathway oor04662   B cell receptor signaling pathway oor04668   TNF signaling pathway oor04713   Circadian entrainment oor04725   Cholinergic synapse oor04728   Dopaminergic synapse oor04915   Estrogen signaling pathway oor04917   Prolactin signaling pathway oor04921   Oxytocin signaling pathway oor04926   Relaxin signaling pathway oor04928   Parathyroid hormone synthesis, secretion and action oor04932   Non-alcoholic fatty liver disease oor04935   Growth hormone synthesis, secretion and action oor05031   Amphetamine addiction oor05132   Salmonella infection oor05133   Pertussis oor05135   Yersinia infection oor05140   Leishmaniasis oor05142   Chagas disease oor05161   Hepatitis B oor05162   Measles oor05166   Human T-cell leukemia virus 1 infection oor05167   Kaposi sarcoma-associated herpesvirus infection oor05170   Human immunodeficiency virus 1 infection oor05171   Coronavirus disease - COVID-19 oor05200   Pathways in cancer oor05207   Chemical carcinogenesis - receptor activation oor05208   Chemical carcinogenesis - reactive oxygen species oor05210   Colorectal cancer oor05224   Breast cancer oor05231   Choline metabolism in cancer oor05235   PD-L1 expression and PD-1 checkpoint pathway in cancer oor05323   Rheumatoid arthritis oor05417   Lipid and atherosclerosis oor05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:oor00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101286650 (FOS)    04668 TNF signaling pathway     101286650 (FOS)    04024 cAMP signaling pathway     101286650 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     101286650 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101286650 (FOS)    04660 T cell receptor signaling pathway     101286650 (FOS)    04658 Th1 and Th2 cell differentiation     101286650 (FOS)    04659 Th17 cell differentiation     101286650 (FOS)    04657 IL-17 signaling pathway     101286650 (FOS)    04662 B cell receptor signaling pathway     101286650 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     101286650 (FOS)    04917 Prolactin signaling pathway     101286650 (FOS)    04921 Oxytocin signaling pathway     101286650 (FOS)    04926 Relaxin signaling pathway     101286650 (FOS)    04935 Growth hormone synthesis, secretion and action     101286650 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     101286650 (FOS)   09156 Nervous system    04725 Cholinergic synapse     101286650 (FOS)    04728 Dopaminergic synapse     101286650 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     101286650 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     101286650 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101286650 (FOS)    05207 Chemical carcinogenesis - receptor activation     101286650 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     101286650 (FOS)    05231 Choline metabolism in cancer     101286650 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     101286650 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     101286650 (FOS)    05224 Breast cancer     101286650 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101286650 (FOS)    05170 Human immunodeficiency virus 1 infection     101286650 (FOS)    05161 Hepatitis B     101286650 (FOS)    05171 Coronavirus disease - COVID-19     101286650 (FOS)    05162 Measles     101286650 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     101286650 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     101286650 (FOS)    05135 Yersinia infection     101286650 (FOS)    05133 Pertussis     101286650 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     101286650 (FOS)    05142 Chagas disease     101286650 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     101286650 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     101286650 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101286650 (FOS)    05418 Fluid shear stress and atherosclerosis     101286650 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     101286650 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     101286650 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:oor03000]     101286650 (FOS)    04131 Membrane trafficking [BR:oor04131]     101286650 (FOS) Transcription factors [BR:oor03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     101286650 (FOS) Membrane trafficking [BR:oor04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     101286650 (FOS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  101286650 NCBI-ProteinID:  XP_004262302 LinkDB All DBs Position 2:174399957..174403423 Genome browser AA seq 380 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSAGAYSRAGVMKTMTGGRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDMGFPEEMSVASLDLSGGLPEAATPESEEAFT LPLLNDPEPKPSVEPVKSISSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA ADWEPLHGGSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttctctggcttcaacgccgactacgaggcgtcatcctcccgctgcagcagcgcc tccccggccggggacagcctctcctactaccactcaccggccgactccttctccagtatg ggctctcccgtcaatgcgcaggacttctgcaccgatctggccgtctccagtgccaacttc atcccaacagtgaccgccatctcgaccagcccggacctgcagtggctagtgcagcccacc ctggtctcctccgtggccccatcccagaccagagccccccacccctatggagtccccacc ccctcggctggggcttactccagggctggagtcatgaagaccatgaccggaggcagagct cagagcattggcaggaggggcaaggtggaacagttgtccccagaagaagaggagaaaagg agaatccgaagggaaaggaataagatggctgcagccaaatgccggaaccggaggagggag ctgactgacacactccaagcggaaacagaccaactagaagatgagaagtctgctttgcag actgagattgccaacctgctaaaggagaaggaaaaactagagttcatcctggcagctcac cgacctgcctgcaagatccctgatgacatgggcttcccagaagaaatgtctgtggcttcc cttgatctgagcgggggcctgcctgaagccgccacccccgaatctgaggaggccttcacc ctacccctccttaatgaccctgagcccaagccctcagtggagcctgtcaagagcatcagc agcatggagctgaaggctgagccctttgatgacttcctgttcccagcatcgtccaggccc agcggctctgagaccgcccgctctgtgccagacatggacctgtctggttccttctatgca gcagactgggagcccctgcacggtggctccctggggatggggcccatggccacagagctg gaacccctgtgcaccccggtggtcacctgtacacccagctgcactacttacacgtcttcc tttgtcttcacctaccctgaggctgactccttccccagctgtgcggctgcccaccgcaag ggcagcagcagcaacgagccctcctctgactcgctcagctcacccacgctgctggccctg tga

DBGET integrated database retrieval system