Orcinus orca (killer whale): 101290331 Help Entry 101290331         CDS       T05247                                  Symbol IL4 Name (RefSeq) interleukin-4   KO K05430   interleukin 4 Organism oor  Orcinus orca (killer whale) Pathway oor04060   Cytokine-cytokine receptor interaction oor04151   PI3K-Akt signaling pathway oor04630   JAK-STAT signaling pathway oor04640   Hematopoietic cell lineage oor04657   IL-17 signaling pathway oor04658   Th1 and Th2 cell differentiation oor04659   Th17 cell differentiation oor04660   T cell receptor signaling pathway oor04664   Fc epsilon RI signaling pathway oor04672   Intestinal immune network for IgA production oor05140   Leishmaniasis oor05200   Pathways in cancer oor05310   Asthma oor05320   Autoimmune thyroid disease oor05321   Inflammatory bowel disease oor05330   Allograft rejection Brite KEGG Orthology (KO) [BR:oor00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     101290331 (IL4)    04151 PI3K-Akt signaling pathway     101290331 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101290331 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     101290331 (IL4)    04660 T cell receptor signaling pathway     101290331 (IL4)    04658 Th1 and Th2 cell differentiation     101290331 (IL4)    04659 Th17 cell differentiation     101290331 (IL4)    04657 IL-17 signaling pathway     101290331 (IL4)    04664 Fc epsilon RI signaling pathway     101290331 (IL4)    04672 Intestinal immune network for IgA production     101290331 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101290331 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     101290331 (IL4)   09163 Immune disease    05310 Asthma     101290331 (IL4)    05320 Autoimmune thyroid disease     101290331 (IL4)    05321 Inflammatory bowel disease     101290331 (IL4)    05330 Allograft rejection     101290331 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oor04052]     101290331 (IL4)    00536 Glycosaminoglycan binding proteins [BR:oor00536]     101290331 (IL4) Cytokines and neuropeptides [BR:oor04052]  Cytokines   Interleukins    101290331 (IL4) Glycosaminoglycan binding proteins [BR:oor00536]  Heparan sulfate / Heparin   Cytokines    101290331 (IL4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL4 Motif Other DBs NCBI-GeneID:  101290331 NCBI-ProteinID:  XP_004279949 LinkDB All DBs Position 3:complement(75308880..75318034) Genome browser AA seq 133 aa AA seqDB search MGLTSQLIPMLVCLLACTSNFVHGHKCDVTLQEIIKTLNILTARKNLCMELPVEDVFATT KNTTEKETFCRAGTVLRHIYRYHKCFNKPLSGLHRNLSSMANMTCSVNEAKKSTLKDFLE RLKMIMKEKYSKC NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atgggtctcacctcccaactgatcccaatgctagtctgcttactggcatgtaccagcaac ttcgtccatggacacaagtgcgatgttaccttacaagagatcatcaaaacgctgaacatc ctcacagcaagaaagaacttgtgcatggagctgcctgtagaagacgtctttgccaccaca aagaacacaactgagaaggaaactttctgcagggccgggactgtgcttcggcatatctac agataccacaagtgcttcaacaaacccctgagtggacttcacaggaacctcagcagcatg gcaaacatgacctgttctgtgaatgaagccaagaagagtacgttgaaagacttcttggaa aggctaaagatgattatgaaggagaaatactcaaagtgttga

DBGET integrated database retrieval system