Ochotona princeps (American pika): 101517703 Help Entry 101517703         CDS       T07609                                  Symbol BAX Name (RefSeq) apoptosis regulator BAX   KO K02159   apoptosis regulator BAX Organism opi  Ochotona princeps (American pika) Pathway opi01521   EGFR tyrosine kinase inhibitor resistance opi01522   Endocrine resistance opi01524   Platinum drug resistance opi04071   Sphingolipid signaling pathway opi04115   p53 signaling pathway opi04141   Protein processing in endoplasmic reticulum opi04210   Apoptosis opi04211   Longevity regulating pathway opi04215   Apoptosis - multiple species opi04217   Necroptosis opi04722   Neurotrophin signaling pathway opi04932   Non-alcoholic fatty liver disease opi04933   AGE-RAGE signaling pathway in diabetic complications opi05012   Parkinson disease opi05014   Amyotrophic lateral sclerosis opi05016   Huntington disease opi05020   Prion disease opi05022   Pathways of neurodegeneration - multiple diseases opi05132   Salmonella infection opi05152   Tuberculosis opi05160   Hepatitis C opi05161   Hepatitis B opi05162   Measles opi05163   Human cytomegalovirus infection opi05164   Influenza A opi05165   Human papillomavirus infection opi05166   Human T-cell leukemia virus 1 infection opi05167   Kaposi sarcoma-associated herpesvirus infection opi05168   Herpes simplex virus 1 infection opi05169   Epstein-Barr virus infection opi05170   Human immunodeficiency virus 1 infection opi05200   Pathways in cancer opi05202   Transcriptional misregulation in cancer opi05203   Viral carcinogenesis opi05210   Colorectal cancer opi05212   Pancreatic cancer opi05213   Endometrial cancer opi05214   Glioma opi05216   Thyroid cancer opi05217   Basal cell carcinoma opi05218   Melanoma opi05220   Chronic myeloid leukemia opi05222   Small cell lung cancer opi05223   Non-small cell lung cancer opi05224   Breast cancer opi05225   Hepatocellular carcinoma opi05226   Gastric cancer opi05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:opi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     101517703 (BAX)  09130 Environmental Information Processing   09132 Signal transduction    04071 Sphingolipid signaling pathway     101517703 (BAX)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     101517703 (BAX)    04215 Apoptosis - multiple species     101517703 (BAX)    04217 Necroptosis     101517703 (BAX)    04115 p53 signaling pathway     101517703 (BAX)  09150 Organismal Systems   09156 Nervous system    04722 Neurotrophin signaling pathway     101517703 (BAX)   09149 Aging    04211 Longevity regulating pathway     101517703 (BAX)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101517703 (BAX)    05202 Transcriptional misregulation in cancer     101517703 (BAX)    05203 Viral carcinogenesis     101517703 (BAX)   09162 Cancer: specific types    05210 Colorectal cancer     101517703 (BAX)    05212 Pancreatic cancer     101517703 (BAX)    05225 Hepatocellular carcinoma     101517703 (BAX)    05226 Gastric cancer     101517703 (BAX)    05214 Glioma     101517703 (BAX)    05216 Thyroid cancer     101517703 (BAX)    05220 Chronic myeloid leukemia     101517703 (BAX)    05217 Basal cell carcinoma     101517703 (BAX)    05218 Melanoma     101517703 (BAX)    05213 Endometrial cancer     101517703 (BAX)    05224 Breast cancer     101517703 (BAX)    05222 Small cell lung cancer     101517703 (BAX)    05223 Non-small cell lung cancer     101517703 (BAX)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101517703 (BAX)    05170 Human immunodeficiency virus 1 infection     101517703 (BAX)    05161 Hepatitis B     101517703 (BAX)    05160 Hepatitis C     101517703 (BAX)    05164 Influenza A     101517703 (BAX)    05162 Measles     101517703 (BAX)    05168 Herpes simplex virus 1 infection     101517703 (BAX)    05163 Human cytomegalovirus infection     101517703 (BAX)    05167 Kaposi sarcoma-associated herpesvirus infection     101517703 (BAX)    05169 Epstein-Barr virus infection     101517703 (BAX)    05165 Human papillomavirus infection     101517703 (BAX)   09171 Infectious disease: bacterial    05132 Salmonella infection     101517703 (BAX)    05152 Tuberculosis     101517703 (BAX)   09164 Neurodegenerative disease    05012 Parkinson disease     101517703 (BAX)    05014 Amyotrophic lateral sclerosis     101517703 (BAX)    05016 Huntington disease     101517703 (BAX)    05020 Prion disease     101517703 (BAX)    05022 Pathways of neurodegeneration - multiple diseases     101517703 (BAX)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101517703 (BAX)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     101517703 (BAX)    04933 AGE-RAGE signaling pathway in diabetic complications     101517703 (BAX)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     101517703 (BAX)    01524 Platinum drug resistance     101517703 (BAX)    01522 Endocrine resistance     101517703 (BAX)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:opi03029]     101517703 (BAX)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:opi02000]     101517703 (BAX) Mitochondrial biogenesis [BR:opi03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Fission and Fusion factors     101517703 (BAX) Transporters [BR:opi02000]  Other transporters   Pores ion channels [TC:1]    101517703 (BAX) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 Motif Other DBs NCBI-GeneID:  101517703 NCBI-ProteinID:  XP_004599913 LinkDB All DBs Position 5:complement(2409728..2412896) Genome browser AA seq 168 aa AA seqDB search MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGQMGDQIPELALEHVAPDESTKRLS ECLKRIGDELDSNVELQRMIAAVDTDSPREVFFRVAADMFADGHFNWGRIVALFYFATKL VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQEQGGWVRLPPRPLTR NT seq 507 nt NT seq  +upstreamnt  +downstreamnt atggacgggtccggggagcagcccagaggcggggggcccaccagctctgagcagatcatg aagacaggtgccctcttgcttcagggtttcatccaggaccgggcgggccaaatgggggat cagatccctgagctggccttggagcacgtggccccggatgagtccaccaagagactgagc gagtgtctgaaacgcatcggggacgaactggacagtaacgtggaactgcagaggatgatc gcggctgtggacacggactccccccgagaggtctttttccgagtggcagccgacatgttt gccgacggccacttcaattggggccggattgtcgcccttttttactttgctaccaaactg gtgctgaaggccttgtgcacgaaggtgcctgagctcatcagaacgattatgggctggacg ttggacttcctccgagagcggctgctgggctggatccaagagcagggtggctgggtgaga cttccaccccgccccctcacccgctga

DBGET integrated database retrieval system