Ochotona princeps (American pika): 101517961 Help Entry 101517961         CDS       T07609                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism opi  Ochotona princeps (American pika) Pathway opi04010   MAPK signaling pathway opi04020   Calcium signaling pathway opi04022   cGMP-PKG signaling pathway opi04114   Oocyte meiosis opi04218   Cellular senescence opi04310   Wnt signaling pathway opi04360   Axon guidance opi04370   VEGF signaling pathway opi04380   Osteoclast differentiation opi04625   C-type lectin receptor signaling pathway opi04650   Natural killer cell mediated cytotoxicity opi04658   Th1 and Th2 cell differentiation opi04659   Th17 cell differentiation opi04660   T cell receptor signaling pathway opi04662   B cell receptor signaling pathway opi04720   Long-term potentiation opi04724   Glutamatergic synapse opi04921   Oxytocin signaling pathway opi04922   Glucagon signaling pathway opi04924   Renin secretion opi05010   Alzheimer disease opi05014   Amyotrophic lateral sclerosis opi05020   Prion disease opi05022   Pathways of neurodegeneration - multiple diseases opi05031   Amphetamine addiction opi05152   Tuberculosis opi05163   Human cytomegalovirus infection opi05166   Human T-cell leukemia virus 1 infection opi05167   Kaposi sarcoma-associated herpesvirus infection opi05170   Human immunodeficiency virus 1 infection opi05235   PD-L1 expression and PD-1 checkpoint pathway in cancer opi05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:opi00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101517961 (PPP3R2)    04310 Wnt signaling pathway     101517961 (PPP3R2)    04370 VEGF signaling pathway     101517961 (PPP3R2)    04020 Calcium signaling pathway     101517961 (PPP3R2)    04022 cGMP-PKG signaling pathway     101517961 (PPP3R2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     101517961 (PPP3R2)    04218 Cellular senescence     101517961 (PPP3R2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101517961 (PPP3R2)    04650 Natural killer cell mediated cytotoxicity     101517961 (PPP3R2)    04660 T cell receptor signaling pathway     101517961 (PPP3R2)    04658 Th1 and Th2 cell differentiation     101517961 (PPP3R2)    04659 Th17 cell differentiation     101517961 (PPP3R2)    04662 B cell receptor signaling pathway     101517961 (PPP3R2)   09152 Endocrine system    04922 Glucagon signaling pathway     101517961 (PPP3R2)    04921 Oxytocin signaling pathway     101517961 (PPP3R2)    04924 Renin secretion     101517961 (PPP3R2)   09156 Nervous system    04724 Glutamatergic synapse     101517961 (PPP3R2)    04720 Long-term potentiation     101517961 (PPP3R2)   09158 Development and regeneration    04360 Axon guidance     101517961 (PPP3R2)    04380 Osteoclast differentiation     101517961 (PPP3R2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     101517961 (PPP3R2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101517961 (PPP3R2)    05170 Human immunodeficiency virus 1 infection     101517961 (PPP3R2)    05163 Human cytomegalovirus infection     101517961 (PPP3R2)    05167 Kaposi sarcoma-associated herpesvirus infection     101517961 (PPP3R2)   09171 Infectious disease: bacterial    05152 Tuberculosis     101517961 (PPP3R2)   09164 Neurodegenerative disease    05010 Alzheimer disease     101517961 (PPP3R2)    05014 Amyotrophic lateral sclerosis     101517961 (PPP3R2)    05020 Prion disease     101517961 (PPP3R2)    05022 Pathways of neurodegeneration - multiple diseases     101517961 (PPP3R2)   09165 Substance dependence    05031 Amphetamine addiction     101517961 (PPP3R2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101517961 (PPP3R2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:opi01009]     101517961 (PPP3R2) Protein phosphatases and associated proteins [BR:opi01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      101517961 (PPP3R2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EH SPARC_Ca_bdg EF-hand_9 YtfJ_HI0045 Motif Other DBs NCBI-GeneID:  101517961 NCBI-ProteinID:  XP_004580995 LinkDB All DBs Position 1A:26149874..26150789 Genome browser AA seq 170 aa AA seqDB search MGNESSYPAEICSHFDHDEIKRLGKRFRKLDLDQSGTLSVEEFLSLPQLEQNPLAKRVID IFDIDGNGEVDFKEFILGTSQFSVKGEEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMV GNNLRDWHLQQLVDKTIITLDKDGDGKISFEEFSAVVRGLEFHKKLVIVV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaacgagtccagttacccagcagagatatgctcccactttgaccatgatgaaatc aaaagactgggcaaaaggtttagaaagctggacctggaccagtcaggcactctgagcgtg gaggagttcttgtccctgccccagctggagcagaaccctttggcgaagcgagtgatcgat atctttgacatagacggcaatggcgaagtggacttcaaggaattcatcttggggacctcc cagttcagcgtcaaaggtgaggaggagcagaagctgaggtttgctttcagcatctacgac atggataaagacggctacatttccaacggagagctcttccaggtgctgaagatgatggtg ggtaacaacctcagggactggcacctgcagcagctggtggacaaaaccatcatcaccctg gataaggatggcgatggcaaaatatcctttgaggagttcagcgctgttgtcagaggcctg gagttccacaagaagttggtcattgtcgtgtga

DBGET integrated database retrieval system