Ochotona princeps (American pika): 101518143 Help Entry 101518143         CDS       T07609                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism opi  Ochotona princeps (American pika) Pathway opi01521   EGFR tyrosine kinase inhibitor resistance opi01524   Platinum drug resistance opi04014   Ras signaling pathway opi04064   NF-kappa B signaling pathway opi04115   p53 signaling pathway opi04137   Mitophagy - animal opi04140   Autophagy - animal opi04151   PI3K-Akt signaling pathway opi04210   Apoptosis opi04215   Apoptosis - multiple species opi04621   NOD-like receptor signaling pathway opi04630   JAK-STAT signaling pathway opi05012   Parkinson disease opi05014   Amyotrophic lateral sclerosis opi05022   Pathways of neurodegeneration - multiple diseases opi05145   Toxoplasmosis opi05162   Measles opi05166   Human T-cell leukemia virus 1 infection opi05168   Herpes simplex virus 1 infection opi05170   Human immunodeficiency virus 1 infection opi05200   Pathways in cancer opi05202   Transcriptional misregulation in cancer opi05212   Pancreatic cancer opi05220   Chronic myeloid leukemia opi05222   Small cell lung cancer opi05225   Hepatocellular carcinoma opi05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:opi00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     101518143 (BCL2L1)    04630 JAK-STAT signaling pathway     101518143 (BCL2L1)    04064 NF-kappa B signaling pathway     101518143 (BCL2L1)    04151 PI3K-Akt signaling pathway     101518143 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101518143 (BCL2L1)    04137 Mitophagy - animal     101518143 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     101518143 (BCL2L1)    04215 Apoptosis - multiple species     101518143 (BCL2L1)    04115 p53 signaling pathway     101518143 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     101518143 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101518143 (BCL2L1)    05202 Transcriptional misregulation in cancer     101518143 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     101518143 (BCL2L1)    05225 Hepatocellular carcinoma     101518143 (BCL2L1)    05220 Chronic myeloid leukemia     101518143 (BCL2L1)    05222 Small cell lung cancer     101518143 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101518143 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     101518143 (BCL2L1)    05162 Measles     101518143 (BCL2L1)    05168 Herpes simplex virus 1 infection     101518143 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     101518143 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     101518143 (BCL2L1)    05014 Amyotrophic lateral sclerosis     101518143 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     101518143 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101518143 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     101518143 (BCL2L1)    01524 Platinum drug resistance     101518143 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:opi01009]     101518143 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:opi03036]     101518143 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:opi02000]     101518143 (BCL2L1) Protein phosphatases and associated proteins [BR:opi01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      101518143 (BCL2L1) Chromosome and associated proteins [BR:opi03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     101518143 (BCL2L1) Transporters [BR:opi02000]  Other transporters   Pores ion channels [TC:1]    101518143 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 PROCT Motif Other DBs NCBI-GeneID:  101518143 NCBI-ProteinID:  XP_004585761 LinkDB All DBs Position 4A:complement(19365938..19431439) Genome browser AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVDDTRTEAPEGIEPEMETPSTLNGTPAWHPA DSPALNGATGPSSSLDAREVIPMSAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTLAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagtaaccgggagctggtggttgactttctctcctacaagctgtcacagaaa ggatacagctggagccagtttagtgatgtggacgacaccaggactgaggccccagaaggg attgagccagagatggagacccccagcaccctcaatggcaccccggcctggcacccagcg gacagccctgcactgaatggagctacgggccccagcagcagcttggatgcccgggaggtg atccccatgtcagcggtgaaacaagctctcagagaggcaggggatgaatttgaactgagg taccggcgggcattcagcgatctgacgtcccaactgcacatcaccccagggacagcgtat cagagctttgagcaagtcgtcaacgaactcttccgtgatggggtcaactggggtcgcatc gtggcctttttctccttcggcggggcactgtgtgtggagagcgtggacaaggagatgcag gtcttggtgagtcggatcgcggcgtggatggccacttacctgaacgaccacttggagcct tggatccaggagaacggcggctgggacacgttcgtggagctgtatggcaacaatgcagca gccgagagccgcaagggccaggagcgcttcaaccgctggttcttgacaggcatgaccctg gcaggcgtggttctgctgggctcgctcttcagtcggaaatga

DBGET integrated database retrieval system