Ochotona princeps (American pika): 101519557 Help Entry 101519557         CDS       T07609                                  Symbol PFN1 Name (RefSeq) profilin-1   KO K05759   profilin Organism opi  Ochotona princeps (American pika) Pathway opi04015   Rap1 signaling pathway opi04810   Regulation of actin cytoskeleton opi05014   Amyotrophic lateral sclerosis opi05132   Salmonella infection Brite KEGG Orthology (KO) [BR:opi00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     101519557 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     101519557 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101519557 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     101519557 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:opi04131]     101519557 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:opi04812]     101519557 (PFN1)    04147 Exosome [BR:opi04147]     101519557 (PFN1) Membrane trafficking [BR:opi04131]  Others   Actin-binding proteins    Others     101519557 (PFN1) Cytoskeleton proteins [BR:opi04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      101519557 (PFN1) Exosome [BR:opi04147]  Exosomal proteins   Proteins found in most exosomes    101519557 (PFN1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  101519557 NCBI-ProteinID:  XP_004594978 LinkDB All DBs Position 19:44392426..44392650 Genome browser AA seq 75 aa AA seqDB search MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGQDRSSFF VNGLTLGGQKCSVIR NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctacatcgacaacctcatggcggatgggacctgtcaggacgcg gccatcgtaggctacaaggactcgccctcggtctgggccgccgtgccgggcaaaaccttc gtcaacatcacgccagctgaggttggtgtcctggttggccaagaccggtcaagcttcttt gtgaatgggctgacacttgggggccagaagtgctcggtgattcgg

DBGET integrated database retrieval system