Ochotona princeps (American pika): 101520284 Help Entry 101520284         CDS       T07609                                  Symbol CSTB Name (RefSeq) cystatin-B   KO K13907   cystatin-A/B Organism opi  Ochotona princeps (American pika) Brite KEGG Orthology (KO) [BR:opi00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:opi01002]     101520284 (CSTB)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:opi04147]     101520284 (CSTB) Peptidases and inhibitors [BR:opi01002]  Peptidase inhibitors   Family I25: cystatin family    101520284 (CSTB) Exosome [BR:opi04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    101520284 (CSTB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin Dynein_light SQAPI Transposase_24 Motif Other DBs NCBI-GeneID:  101520284 NCBI-ProteinID:  XP_004594144 LinkDB All DBs Position 14:complement(121315537..121318173) Genome browser AA seq 98 aa AA seqDB search MMCGGPSATQPATAETQHIADQVKSQLEEKENRKYSEFKAVSFKSQVVAGTNYFIKVHVG DSSFVHLRVFKSLPHENRPLALSDYQVNKAEQDELTYF NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgatgtgtggagggccttccgccacgcagcccgccacggccgagacccagcacatcgcc gaccaggtgaagtcccagctggaggagaaggagaaccgcaagtacagcgagttcaaggcc gtgtccttcaagagccaggtggtcgcagggaccaactacttcatcaaggtgcatgtgggc gacagcagcttcgtgcacctgcgtgtgttcaagagccttcctcatgagaaccggcccctg gccctgtctgactaccaggtcaacaaggccgagcaggatgagctcacctacttctag

DBGET integrated database retrieval system