Ochotona princeps (American pika): 101520719 Help Entry 101520719         CDS       T07609                                  Name (RefSeq) ras-related protein M-Ras-like   KO K07831   Ras-related protein M-Ras Organism opi  Ochotona princeps (American pika) Pathway opi04010   MAPK signaling pathway opi04014   Ras signaling pathway opi04015   Rap1 signaling pathway opi04072   Phospholipase D signaling pathway opi04137   Mitophagy - animal opi04140   Autophagy - animal opi04218   Cellular senescence opi04371   Apelin signaling pathway opi04519   Cadherin signaling opi04625   C-type lectin receptor signaling pathway opi04810   Regulation of actin cytoskeleton opi05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:opi00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101520719    04014 Ras signaling pathway     101520719    04015 Rap1 signaling pathway     101520719    04371 Apelin signaling pathway     101520719    04072 Phospholipase D signaling pathway     101520719   09133 Signaling molecules and interaction    04519 Cadherin signaling     101520719  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101520719    04137 Mitophagy - animal     101520719   09143 Cell growth and death    04218 Cellular senescence     101520719   09142 Cell motility    04810 Regulation of actin cytoskeleton     101520719  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101520719  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     101520719  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:opi04031]     101520719 GTP-binding proteins [BR:opi04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     101520719 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf Motif Other DBs NCBI-GeneID:  101520719 NCBI-ProteinID:  XP_036348780 LinkDB All DBs Position 6:34516484..34516972 Genome browser AA seq 144 aa AA seqDB search MLDMAGQEEFSAMREQYMRTGDGFLIVFSITDKVSFENVDRFHQLILRVKDRESFLMILV AKKMDLMHLRKITREQGKEMAAKHNIPYIETSAQDPPLNVDKAFHDLVRVIRQQIPEKSQ KEKKKTKWRGDRATGTHKLQCVIL NT seq 435 nt NT seq  +upstreamnt  +downstreamnt atgctggacatggccgggcaggaggagttcagcgccatgcgcgagcagtacatgcgcacc ggggatggcttcctcatcgtcttctccatcacagacaaggtcagctttgagaacgtggac cgcttccaccagctcatcctccgtgtcaaggacagggagtcattcctgatgatcctcgtg gccaaaaagatggatctgatgcacttgaggaaaatcaccagggagcagggcaaggagatg gcggccaaacacaatattccatacatagagaccagcgcccaggacccccctctcaatgtg gacaaagccttccatgacctcgttagagtaatcaggcaacagattccggaaaaaagccag aaggagaagaagaaaactaaatggcggggagaccgggccactggcacccacaaactgcag tgcgtgattttgtga

DBGET integrated database retrieval system