Ochotona princeps (American pika): 101521721 Help Entry 101521721         CDS       T07609                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism opi  Ochotona princeps (American pika) Pathway opi04015   Rap1 signaling pathway opi04810   Regulation of actin cytoskeleton opi05014   Amyotrophic lateral sclerosis opi05132   Salmonella infection Brite KEGG Orthology (KO) [BR:opi00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     101521721 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     101521721 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101521721 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     101521721 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:opi04131]     101521721 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:opi04812]     101521721 (PFN3)    04147 Exosome [BR:opi04147]     101521721 (PFN3) Membrane trafficking [BR:opi04131]  Others   Actin-binding proteins    Others     101521721 (PFN3) Cytoskeleton proteins [BR:opi04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      101521721 (PFN3) Exosome [BR:opi04147]  Exosomal proteins   Proteins found in most exosomes    101521721 (PFN3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Terminase-T7_RNaseH-like Motif Other DBs NCBI-GeneID:  101521721 NCBI-ProteinID:  XP_004587434 LinkDB All DBs Position 3A:1595346..1595768 Genome browser AA seq 137 aa AA seqDB search MGDWKGYISAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRQTFL QAGLSVAGRRCCVIRDYLLAEGDGVLDARTKGLDGRAVCVGHTPRALLVLMGRRGVHGGL LNKTVHELIRGLRKQGA NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggcgactggaagggctacatcagtgcggtgctgcgggaccagcgcatcgacgacgtg gccatcgtgggccactcggacaatcgctgcgtgtgggcgtcgcggcccgggggcctgctg gccgccatctccccgcaggaggtgggtgtgctcaccgggcccgaccggcagaccttcctg caggccggtctgagtgtggccggccgccgctgctgtgtcatccgtgactacctgctggct gagggcgacggtgtgctggacgcgcgcaccaaggggctggatgggcgtgccgtctgcgtg ggccacacgccgcgcgcgctcctcgtgctcatgggccggcgcggcgtgcatggaggactc ctcaataagacagtgcacgagctaatccgtgggctgcgcaagcagggcgcctag

DBGET integrated database retrieval system