Ochotona princeps (American pika): 101523093 Help Entry 101523093         CDS       T07609                                  Symbol GAST Name (RefSeq) gastrin   KO K13768   gastrin Organism opi  Ochotona princeps (American pika) Pathway opi04081   Hormone signaling opi04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:opi00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     101523093 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     101523093 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:opi04052]     101523093 (GAST) Cytokines and neuropeptides [BR:opi04052]  Neuropeptides   GPCR binding    101523093 (GAST) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  101523093 NCBI-ProteinID:  XP_004599146 LinkDB All DBs Position 19:5333218..5333630 Genome browser AA seq 104 aa AA seqDB search MPQPCVSVLVLVLALAAFCHASWRPHSQLQDAPSGPAAHSGLEPRWPDQQGSATYHRRQL EPPAVARLVPDLSKKQGPWLQEEEEAYGWMDFGRRSAEEVEQHP NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgccgcagccgtgtgtgtccgtgctggtcttggtgctggccctggccgccttctgccat gcttcttggaggcctcactcccagctgcaggatgcaccctcgggaccagcggcccacagt ggtctggagccacgttggccagatcagcagggctcggcaacttaccaccggaggcagctg gaacctccagctgtcgcacgcctcgtgccagatctgtccaagaagcagggaccctggctt caggaagaggaggaggcttatggctggatggacttcggccgtcgcagcgcagaggaagtg gaacagcatccttag

DBGET integrated database retrieval system