Ochotona princeps (American pika): 101523213 Help Entry 101523213         CDS       T07609                                  Name (RefSeq) C-C motif chemokine 3-like   KO K05408   C-C motif chemokine 3 Organism opi  Ochotona princeps (American pika) Pathway opi04060   Cytokine-cytokine receptor interaction opi04061   Viral protein interaction with cytokine and cytokine receptor opi04062   Chemokine signaling pathway opi04620   Toll-like receptor signaling pathway opi05142   Chagas disease opi05163   Human cytomegalovirus infection opi05323   Rheumatoid arthritis opi05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:opi00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101523213    04061 Viral protein interaction with cytokine and cytokine receptor     101523213  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101523213    04062 Chemokine signaling pathway     101523213  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     101523213   09174 Infectious disease: parasitic    05142 Chagas disease     101523213   09163 Immune disease    05323 Rheumatoid arthritis     101523213   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101523213  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:opi04052]     101523213    00536 Glycosaminoglycan binding proteins [BR:opi00536]     101523213 Cytokines and neuropeptides [BR:opi04052]  Cytokines   Chemokines    101523213 Glycosaminoglycan binding proteins [BR:opi00536]  Heparan sulfate / Heparin   Chemokines    101523213 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  101523213 NCBI-ProteinID:  XP_004590991 LinkDB All DBs Position 19:24078075..24079312 Genome browser AA seq 95 aa AA seqDB search MEIPTAVLAVLFLMGTLCSQTCPAYHEFGANTPTACCFLYISRQIPCKFVNDYYETSSQC YKPGIIFQTKRDRQVCADPSETWVQEYISELEMNA NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggagatccccacagctgtcctcgctgtcctgttcctcatggggaccctctgctctcag acctgccctgcctaccatgagtttggtgccaacaccccgaccgcctgctgcttcctgtac atctcccggcagattccatgcaagtttgtgaatgactactatgagaccagcagccagtgc tacaagccaggcatcatcttccagaccaagagagaccgccaggtctgtgctgaccccagt gagacctgggtccaggagtacatctctgaactggagatgaatgcctga

DBGET integrated database retrieval system