Ochotona princeps (American pika): 101524465 Help Entry 101524465         CDS       T07609                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism opi  Ochotona princeps (American pika) Pathway opi01521   EGFR tyrosine kinase inhibitor resistance opi01522   Endocrine resistance opi04010   MAPK signaling pathway opi04012   ErbB signaling pathway opi04014   Ras signaling pathway opi04015   Rap1 signaling pathway opi04062   Chemokine signaling pathway opi04068   FoxO signaling pathway opi04071   Sphingolipid signaling pathway opi04072   Phospholipase D signaling pathway opi04137   Mitophagy - animal opi04140   Autophagy - animal opi04150   mTOR signaling pathway opi04151   PI3K-Akt signaling pathway opi04210   Apoptosis opi04211   Longevity regulating pathway opi04213   Longevity regulating pathway - multiple species opi04218   Cellular senescence opi04360   Axon guidance opi04370   VEGF signaling pathway opi04371   Apelin signaling pathway opi04540   Gap junction opi04550   Signaling pathways regulating pluripotency of stem cells opi04625   C-type lectin receptor signaling pathway opi04650   Natural killer cell mediated cytotoxicity opi04660   T cell receptor signaling pathway opi04662   B cell receptor signaling pathway opi04664   Fc epsilon RI signaling pathway opi04714   Thermogenesis opi04720   Long-term potentiation opi04722   Neurotrophin signaling pathway opi04725   Cholinergic synapse opi04726   Serotonergic synapse opi04730   Long-term depression opi04810   Regulation of actin cytoskeleton opi04910   Insulin signaling pathway opi04912   GnRH signaling pathway opi04915   Estrogen signaling pathway opi04916   Melanogenesis opi04917   Prolactin signaling pathway opi04919   Thyroid hormone signaling pathway opi04921   Oxytocin signaling pathway opi04926   Relaxin signaling pathway opi04929   GnRH secretion opi04933   AGE-RAGE signaling pathway in diabetic complications opi04935   Growth hormone synthesis, secretion and action opi05010   Alzheimer disease opi05022   Pathways of neurodegeneration - multiple diseases opi05034   Alcoholism opi05160   Hepatitis C opi05161   Hepatitis B opi05163   Human cytomegalovirus infection opi05165   Human papillomavirus infection opi05166   Human T-cell leukemia virus 1 infection opi05167   Kaposi sarcoma-associated herpesvirus infection opi05170   Human immunodeficiency virus 1 infection opi05200   Pathways in cancer opi05203   Viral carcinogenesis opi05205   Proteoglycans in cancer opi05206   MicroRNAs in cancer opi05207   Chemical carcinogenesis - receptor activation opi05208   Chemical carcinogenesis - reactive oxygen species opi05210   Colorectal cancer opi05211   Renal cell carcinoma opi05213   Endometrial cancer opi05214   Glioma opi05215   Prostate cancer opi05216   Thyroid cancer opi05218   Melanoma opi05219   Bladder cancer opi05220   Chronic myeloid leukemia opi05221   Acute myeloid leukemia opi05223   Non-small cell lung cancer opi05224   Breast cancer opi05225   Hepatocellular carcinoma opi05226   Gastric cancer opi05230   Central carbon metabolism in cancer opi05231   Choline metabolism in cancer opi05235   PD-L1 expression and PD-1 checkpoint pathway in cancer opi05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:opi00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101524465 (NRAS)    04012 ErbB signaling pathway     101524465 (NRAS)    04014 Ras signaling pathway     101524465 (NRAS)    04015 Rap1 signaling pathway     101524465 (NRAS)    04370 VEGF signaling pathway     101524465 (NRAS)    04371 Apelin signaling pathway     101524465 (NRAS)    04068 FoxO signaling pathway     101524465 (NRAS)    04072 Phospholipase D signaling pathway     101524465 (NRAS)    04071 Sphingolipid signaling pathway     101524465 (NRAS)    04151 PI3K-Akt signaling pathway     101524465 (NRAS)    04150 mTOR signaling pathway     101524465 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101524465 (NRAS)    04137 Mitophagy - animal     101524465 (NRAS)   09143 Cell growth and death    04210 Apoptosis     101524465 (NRAS)    04218 Cellular senescence     101524465 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     101524465 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     101524465 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     101524465 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101524465 (NRAS)    04650 Natural killer cell mediated cytotoxicity     101524465 (NRAS)    04660 T cell receptor signaling pathway     101524465 (NRAS)    04662 B cell receptor signaling pathway     101524465 (NRAS)    04664 Fc epsilon RI signaling pathway     101524465 (NRAS)    04062 Chemokine signaling pathway     101524465 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     101524465 (NRAS)    04929 GnRH secretion     101524465 (NRAS)    04912 GnRH signaling pathway     101524465 (NRAS)    04915 Estrogen signaling pathway     101524465 (NRAS)    04917 Prolactin signaling pathway     101524465 (NRAS)    04921 Oxytocin signaling pathway     101524465 (NRAS)    04926 Relaxin signaling pathway     101524465 (NRAS)    04935 Growth hormone synthesis, secretion and action     101524465 (NRAS)    04919 Thyroid hormone signaling pathway     101524465 (NRAS)    04916 Melanogenesis     101524465 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     101524465 (NRAS)    04726 Serotonergic synapse     101524465 (NRAS)    04720 Long-term potentiation     101524465 (NRAS)    04730 Long-term depression     101524465 (NRAS)    04722 Neurotrophin signaling pathway     101524465 (NRAS)   09158 Development and regeneration    04360 Axon guidance     101524465 (NRAS)   09149 Aging    04211 Longevity regulating pathway     101524465 (NRAS)    04213 Longevity regulating pathway - multiple species     101524465 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     101524465 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101524465 (NRAS)    05206 MicroRNAs in cancer     101524465 (NRAS)    05205 Proteoglycans in cancer     101524465 (NRAS)    05207 Chemical carcinogenesis - receptor activation     101524465 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     101524465 (NRAS)    05203 Viral carcinogenesis     101524465 (NRAS)    05230 Central carbon metabolism in cancer     101524465 (NRAS)    05231 Choline metabolism in cancer     101524465 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     101524465 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     101524465 (NRAS)    05225 Hepatocellular carcinoma     101524465 (NRAS)    05226 Gastric cancer     101524465 (NRAS)    05214 Glioma     101524465 (NRAS)    05216 Thyroid cancer     101524465 (NRAS)    05221 Acute myeloid leukemia     101524465 (NRAS)    05220 Chronic myeloid leukemia     101524465 (NRAS)    05218 Melanoma     101524465 (NRAS)    05211 Renal cell carcinoma     101524465 (NRAS)    05219 Bladder cancer     101524465 (NRAS)    05215 Prostate cancer     101524465 (NRAS)    05213 Endometrial cancer     101524465 (NRAS)    05224 Breast cancer     101524465 (NRAS)    05223 Non-small cell lung cancer     101524465 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101524465 (NRAS)    05170 Human immunodeficiency virus 1 infection     101524465 (NRAS)    05161 Hepatitis B     101524465 (NRAS)    05160 Hepatitis C     101524465 (NRAS)    05163 Human cytomegalovirus infection     101524465 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     101524465 (NRAS)    05165 Human papillomavirus infection     101524465 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     101524465 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     101524465 (NRAS)   09165 Substance dependence    05034 Alcoholism     101524465 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101524465 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     101524465 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     101524465 (NRAS)    01522 Endocrine resistance     101524465 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:opi04131]     101524465 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:opi04147]     101524465 (NRAS)    04031 GTP-binding proteins [BR:opi04031]     101524465 (NRAS) Membrane trafficking [BR:opi04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     101524465 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     101524465 (NRAS) Exosome [BR:opi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101524465 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    101524465 (NRAS)   Exosomal proteins of breast cancer cells    101524465 (NRAS)   Exosomal proteins of colorectal cancer cells    101524465 (NRAS) GTP-binding proteins [BR:opi04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     101524465 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc RsgA_GTPase Arf GTP_EFTU FeoB_N AAA_14 Septin nSTAND3 ParA NB-ARC Aldo_ket_red AAA_16 ATPase_2 Viral_helicase1 MMR_HSR1 Ldh_1_N Motif Other DBs NCBI-GeneID:  101524465 NCBI-ProteinID:  XP_004582194 LinkDB All DBs Position 13:complement(102338254..102348452) Genome browser AA seq 132 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEVQWEQIKRVKDSDDVPMVLVGNK CDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDG TQGCMGLPCVVM NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca atccagctaatccagaaccactttgtggatgaatatgatcctaccatagaggttcaatgg gaacagattaagcgagtgaaagattcagatgatgtacctatggtgctggtaggaaacaag tgtgacttgccaacaaggacggttgacacaaaacaagcccatgaactggccaagagttac gggattccgttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttac acactggtaagagaaatacgccagtaccgaatgaaaaagctcaacagcagtgatgatgga actcaaggttgtatggggttgccctgtgtggtgatgtaa

DBGET integrated database retrieval system