KEGG   Ochotona princeps (American pika): 101525427
Entry
101525427         CDS       T07609                                 
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
opi  Ochotona princeps (American pika)
Pathway
opi01521  EGFR tyrosine kinase inhibitor resistance
opi01522  Endocrine resistance
opi01524  Platinum drug resistance
opi04010  MAPK signaling pathway
opi04012  ErbB signaling pathway
opi04014  Ras signaling pathway
opi04015  Rap1 signaling pathway
opi04022  cGMP-PKG signaling pathway
opi04024  cAMP signaling pathway
opi04062  Chemokine signaling pathway
opi04066  HIF-1 signaling pathway
opi04068  FoxO signaling pathway
opi04071  Sphingolipid signaling pathway
opi04072  Phospholipase D signaling pathway
opi04114  Oocyte meiosis
opi04140  Autophagy - animal
opi04148  Efferocytosis
opi04150  mTOR signaling pathway
opi04151  PI3K-Akt signaling pathway
opi04210  Apoptosis
opi04218  Cellular senescence
opi04261  Adrenergic signaling in cardiomyocytes
opi04270  Vascular smooth muscle contraction
opi04350  TGF-beta signaling pathway
opi04360  Axon guidance
opi04370  VEGF signaling pathway
opi04371  Apelin signaling pathway
opi04380  Osteoclast differentiation
opi04510  Focal adhesion
opi04517  IgSF CAM signaling
opi04520  Adherens junction
opi04540  Gap junction
opi04550  Signaling pathways regulating pluripotency of stem cells
opi04611  Platelet activation
opi04613  Neutrophil extracellular trap formation
opi04620  Toll-like receptor signaling pathway
opi04621  NOD-like receptor signaling pathway
opi04625  C-type lectin receptor signaling pathway
opi04650  Natural killer cell mediated cytotoxicity
opi04657  IL-17 signaling pathway
opi04658  Th1 and Th2 cell differentiation
opi04659  Th17 cell differentiation
opi04660  T cell receptor signaling pathway
opi04662  B cell receptor signaling pathway
opi04664  Fc epsilon RI signaling pathway
opi04666  Fc gamma R-mediated phagocytosis
opi04668  TNF signaling pathway
opi04713  Circadian entrainment
opi04720  Long-term potentiation
opi04722  Neurotrophin signaling pathway
opi04723  Retrograde endocannabinoid signaling
opi04724  Glutamatergic synapse
opi04725  Cholinergic synapse
opi04726  Serotonergic synapse
opi04730  Long-term depression
opi04810  Regulation of actin cytoskeleton
opi04910  Insulin signaling pathway
opi04912  GnRH signaling pathway
opi04914  Progesterone-mediated oocyte maturation
opi04915  Estrogen signaling pathway
opi04916  Melanogenesis
opi04917  Prolactin signaling pathway
opi04919  Thyroid hormone signaling pathway
opi04921  Oxytocin signaling pathway
opi04926  Relaxin signaling pathway
opi04928  Parathyroid hormone synthesis, secretion and action
opi04929  GnRH secretion
opi04930  Type II diabetes mellitus
opi04933  AGE-RAGE signaling pathway in diabetic complications
opi04934  Cushing syndrome
opi04935  Growth hormone synthesis, secretion and action
opi04960  Aldosterone-regulated sodium reabsorption
opi05010  Alzheimer disease
opi05020  Prion disease
opi05022  Pathways of neurodegeneration - multiple diseases
opi05034  Alcoholism
opi05132  Salmonella infection
opi05133  Pertussis
opi05135  Yersinia infection
opi05140  Leishmaniasis
opi05142  Chagas disease
opi05145  Toxoplasmosis
opi05152  Tuberculosis
opi05160  Hepatitis C
opi05161  Hepatitis B
opi05163  Human cytomegalovirus infection
opi05164  Influenza A
opi05165  Human papillomavirus infection
opi05166  Human T-cell leukemia virus 1 infection
opi05167  Kaposi sarcoma-associated herpesvirus infection
opi05170  Human immunodeficiency virus 1 infection
opi05171  Coronavirus disease - COVID-19
opi05200  Pathways in cancer
opi05203  Viral carcinogenesis
opi05205  Proteoglycans in cancer
opi05206  MicroRNAs in cancer
opi05207  Chemical carcinogenesis - receptor activation
opi05208  Chemical carcinogenesis - reactive oxygen species
opi05210  Colorectal cancer
opi05211  Renal cell carcinoma
opi05212  Pancreatic cancer
opi05213  Endometrial cancer
opi05214  Glioma
opi05215  Prostate cancer
opi05216  Thyroid cancer
opi05218  Melanoma
opi05219  Bladder cancer
opi05220  Chronic myeloid leukemia
opi05221  Acute myeloid leukemia
opi05223  Non-small cell lung cancer
opi05224  Breast cancer
opi05225  Hepatocellular carcinoma
opi05226  Gastric cancer
opi05230  Central carbon metabolism in cancer
opi05231  Choline metabolism in cancer
opi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
opi05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:opi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101525427
   04012 ErbB signaling pathway
    101525427
   04014 Ras signaling pathway
    101525427
   04015 Rap1 signaling pathway
    101525427
   04350 TGF-beta signaling pathway
    101525427
   04370 VEGF signaling pathway
    101525427
   04371 Apelin signaling pathway
    101525427
   04668 TNF signaling pathway
    101525427
   04066 HIF-1 signaling pathway
    101525427
   04068 FoxO signaling pathway
    101525427
   04072 Phospholipase D signaling pathway
    101525427
   04071 Sphingolipid signaling pathway
    101525427
   04024 cAMP signaling pathway
    101525427
   04022 cGMP-PKG signaling pathway
    101525427
   04151 PI3K-Akt signaling pathway
    101525427
   04150 mTOR signaling pathway
    101525427
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    101525427
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101525427
   04148 Efferocytosis
    101525427
  09143 Cell growth and death
   04114 Oocyte meiosis
    101525427
   04210 Apoptosis
    101525427
   04218 Cellular senescence
    101525427
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101525427
   04520 Adherens junction
    101525427
   04540 Gap junction
    101525427
   04550 Signaling pathways regulating pluripotency of stem cells
    101525427
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101525427
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101525427
   04613 Neutrophil extracellular trap formation
    101525427
   04620 Toll-like receptor signaling pathway
    101525427
   04621 NOD-like receptor signaling pathway
    101525427
   04625 C-type lectin receptor signaling pathway
    101525427
   04650 Natural killer cell mediated cytotoxicity
    101525427
   04660 T cell receptor signaling pathway
    101525427
   04658 Th1 and Th2 cell differentiation
    101525427
   04659 Th17 cell differentiation
    101525427
   04657 IL-17 signaling pathway
    101525427
   04662 B cell receptor signaling pathway
    101525427
   04664 Fc epsilon RI signaling pathway
    101525427
   04666 Fc gamma R-mediated phagocytosis
    101525427
   04062 Chemokine signaling pathway
    101525427
  09152 Endocrine system
   04910 Insulin signaling pathway
    101525427
   04929 GnRH secretion
    101525427
   04912 GnRH signaling pathway
    101525427
   04915 Estrogen signaling pathway
    101525427
   04914 Progesterone-mediated oocyte maturation
    101525427
   04917 Prolactin signaling pathway
    101525427
   04921 Oxytocin signaling pathway
    101525427
   04926 Relaxin signaling pathway
    101525427
   04935 Growth hormone synthesis, secretion and action
    101525427
   04919 Thyroid hormone signaling pathway
    101525427
   04928 Parathyroid hormone synthesis, secretion and action
    101525427
   04916 Melanogenesis
    101525427
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101525427
   04270 Vascular smooth muscle contraction
    101525427
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101525427
  09156 Nervous system
   04724 Glutamatergic synapse
    101525427
   04725 Cholinergic synapse
    101525427
   04726 Serotonergic synapse
    101525427
   04720 Long-term potentiation
    101525427
   04730 Long-term depression
    101525427
   04723 Retrograde endocannabinoid signaling
    101525427
   04722 Neurotrophin signaling pathway
    101525427
  09158 Development and regeneration
   04360 Axon guidance
    101525427
   04380 Osteoclast differentiation
    101525427
  09159 Environmental adaptation
   04713 Circadian entrainment
    101525427
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101525427
   05206 MicroRNAs in cancer
    101525427
   05205 Proteoglycans in cancer
    101525427
   05207 Chemical carcinogenesis - receptor activation
    101525427
   05208 Chemical carcinogenesis - reactive oxygen species
    101525427
   05203 Viral carcinogenesis
    101525427
   05230 Central carbon metabolism in cancer
    101525427
   05231 Choline metabolism in cancer
    101525427
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101525427
  09162 Cancer: specific types
   05210 Colorectal cancer
    101525427
   05212 Pancreatic cancer
    101525427
   05225 Hepatocellular carcinoma
    101525427
   05226 Gastric cancer
    101525427
   05214 Glioma
    101525427
   05216 Thyroid cancer
    101525427
   05221 Acute myeloid leukemia
    101525427
   05220 Chronic myeloid leukemia
    101525427
   05218 Melanoma
    101525427
   05211 Renal cell carcinoma
    101525427
   05219 Bladder cancer
    101525427
   05215 Prostate cancer
    101525427
   05213 Endometrial cancer
    101525427
   05224 Breast cancer
    101525427
   05223 Non-small cell lung cancer
    101525427
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101525427
   05170 Human immunodeficiency virus 1 infection
    101525427
   05161 Hepatitis B
    101525427
   05160 Hepatitis C
    101525427
   05171 Coronavirus disease - COVID-19
    101525427
   05164 Influenza A
    101525427
   05163 Human cytomegalovirus infection
    101525427
   05167 Kaposi sarcoma-associated herpesvirus infection
    101525427
   05165 Human papillomavirus infection
    101525427
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101525427
   05135 Yersinia infection
    101525427
   05133 Pertussis
    101525427
   05152 Tuberculosis
    101525427
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101525427
   05140 Leishmaniasis
    101525427
   05142 Chagas disease
    101525427
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101525427
   05020 Prion disease
    101525427
   05022 Pathways of neurodegeneration - multiple diseases
    101525427
  09165 Substance dependence
   05034 Alcoholism
    101525427
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101525427
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101525427
   04933 AGE-RAGE signaling pathway in diabetic complications
    101525427
   04934 Cushing syndrome
    101525427
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101525427
   01524 Platinum drug resistance
    101525427
   01522 Endocrine resistance
    101525427
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:opi01001]
    101525427
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:opi03036]
    101525427
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:opi04147]
    101525427
Enzymes [BR:opi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101525427
Protein kinases [BR:opi01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101525427
Chromosome and associated proteins [BR:opi03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     101525427
Exosome [BR:opi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101525427
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1
Other DBs
NCBI-GeneID: 101525427
NCBI-ProteinID: XP_004585794
LinkDB
Position
4A:21396113..21397195
AA seq 359 aa
MAVAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCFAYDNVNKVRVAIKKISPFEH
QTYCQRTLREIKILLRFRHEHIIGISDIIRAPTIEPMKDVYIVQDLMETDLYKLLKTQHL
SNDHICYFLYQILQGLKYIHSANVLHRDLKPSNLLLNTTCDLKICEFGLARVADPDHDHT
GFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHIL
GILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKR
IEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggcggtggcggcggcgggcgcgggcccggagatggtccgcgggcaggtgttcgacgtg
gggccgcgctacaccaacctctcgtacatcggcgagggtgcctacggcatggtgtgcttt
gcttatgataacgtcaacaaagttcgagtggctatcaagaaaatcagtccttttgagcac
cagacctattgccagaggaccctgagggagatcaagatcttgctgcgtttcagacatgaa
catatcattgggatcagtgacatcatccgcgcaccgaccatcgagccgatgaaagatgta
tacatagtacaggacctaatggagacagatctctacaagctcttgaagacacagcacctc
agcaacgaccatatctgctattttctttaccagatcctgcaaggattaaaatacattcac
tcagctaacgttctgcaccgcgacctcaagccttccaacctgctgctcaacaccacctgt
gatctcaagatctgtgaatttggcttggcccgcgttgcagatccggaccacgaccacaca
gggttcctgacagagtatgtagccacccgttggtacagggctccagaaattatgttgaat
tccaagggctacaccaagtccatcgacatctggtctgtgggctgcatcctggcggagatg
ctctccaaccggcccatcttcccggggaagcactacctcgaccagctgaaccacattctg
ggtattcttggttccccatcacaagaagacctgaactgtataataaatttaaaagctaga
aactatttgctttctcttccacacaaaaacaaggtgccatggaacaggttgttcccaaat
gccgactccaaagctctggacttgctggacaaaatgttgacattcaaccctcacaagagg
atcgaggtcgaacaggctctggcgcacccctatctggagcaatattatgaccccagtgac
gagcccattgccgaagctccattcaagtttgacatggaattagatgacttgcccaaggaa
aaactcaaggagctcatttttgaagagactgcaagattccagccaggatacagatcttaa

DBGET integrated database retrieval system