Ochotona princeps (American pika): 101526311 Help Entry 101526311         CDS       T07609                                  Name (RefSeq) metallothionein-2   KO K14739   metallothionein 1/2 Organism opi  Ochotona princeps (American pika) Pathway opi04978   Mineral absorption Brite KEGG Orthology (KO) [BR:opi00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     101526311  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:opi03019]     101526311    03029 Mitochondrial biogenesis [BR:opi03029]     101526311 Messenger RNA biogenesis [BR:opi03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      101526311 Mitochondrial biogenesis [BR:opi03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     101526311 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  101526311 NCBI-ProteinID:  XP_004583928 LinkDB All DBs Position 5:28403926..28405293 Genome browser AA seq 61 aa AA seqDB search MDPNCSCSSGDSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggaccccaattgctcctgctcctcaggtgactcctgcacctgtgccagctcctgcaaa tgcaaggaatgcaaatgcacctcctgcaagaagagctgctgctcttgctgccctgtgggc tgtgccaagtgtgcccagggttgcatctgcaaaggggcgtcggacaagtgcagctgctgt gcctga

DBGET integrated database retrieval system