KEGG   Ochotona princeps (American pika): 101527518
Entry
101527518         CDS       T07609                                 
Name
(RefSeq) ras-related C3 botulinum toxin substrate 1-like
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
opi  Ochotona princeps (American pika)
Pathway
opi04010  MAPK signaling pathway
opi04014  Ras signaling pathway
opi04015  Rap1 signaling pathway
opi04024  cAMP signaling pathway
opi04062  Chemokine signaling pathway
opi04071  Sphingolipid signaling pathway
opi04145  Phagosome
opi04148  Efferocytosis
opi04151  PI3K-Akt signaling pathway
opi04310  Wnt signaling pathway
opi04360  Axon guidance
opi04370  VEGF signaling pathway
opi04380  Osteoclast differentiation
opi04510  Focal adhesion
opi04520  Adherens junction
opi04530  Tight junction
opi04613  Neutrophil extracellular trap formation
opi04620  Toll-like receptor signaling pathway
opi04650  Natural killer cell mediated cytotoxicity
opi04662  B cell receptor signaling pathway
opi04664  Fc epsilon RI signaling pathway
opi04666  Fc gamma R-mediated phagocytosis
opi04670  Leukocyte transendothelial migration
opi04722  Neurotrophin signaling pathway
opi04810  Regulation of actin cytoskeleton
opi04932  Non-alcoholic fatty liver disease
opi04933  AGE-RAGE signaling pathway in diabetic complications
opi04972  Pancreatic secretion
opi05014  Amyotrophic lateral sclerosis
opi05020  Prion disease
opi05022  Pathways of neurodegeneration - multiple diseases
opi05100  Bacterial invasion of epithelial cells
opi05132  Salmonella infection
opi05135  Yersinia infection
opi05163  Human cytomegalovirus infection
opi05167  Kaposi sarcoma-associated herpesvirus infection
opi05169  Epstein-Barr virus infection
opi05170  Human immunodeficiency virus 1 infection
opi05200  Pathways in cancer
opi05203  Viral carcinogenesis
opi05205  Proteoglycans in cancer
opi05208  Chemical carcinogenesis - reactive oxygen species
opi05210  Colorectal cancer
opi05211  Renal cell carcinoma
opi05212  Pancreatic cancer
opi05231  Choline metabolism in cancer
opi05415  Diabetic cardiomyopathy
opi05416  Viral myocarditis
opi05417  Lipid and atherosclerosis
opi05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:opi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101527518
   04014 Ras signaling pathway
    101527518
   04015 Rap1 signaling pathway
    101527518
   04310 Wnt signaling pathway
    101527518
   04370 VEGF signaling pathway
    101527518
   04071 Sphingolipid signaling pathway
    101527518
   04024 cAMP signaling pathway
    101527518
   04151 PI3K-Akt signaling pathway
    101527518
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101527518
   04148 Efferocytosis
    101527518
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101527518
   04520 Adherens junction
    101527518
   04530 Tight junction
    101527518
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101527518
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101527518
   04620 Toll-like receptor signaling pathway
    101527518
   04650 Natural killer cell mediated cytotoxicity
    101527518
   04662 B cell receptor signaling pathway
    101527518
   04664 Fc epsilon RI signaling pathway
    101527518
   04666 Fc gamma R-mediated phagocytosis
    101527518
   04670 Leukocyte transendothelial migration
    101527518
   04062 Chemokine signaling pathway
    101527518
  09154 Digestive system
   04972 Pancreatic secretion
    101527518
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101527518
  09158 Development and regeneration
   04360 Axon guidance
    101527518
   04380 Osteoclast differentiation
    101527518
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101527518
   05205 Proteoglycans in cancer
    101527518
   05208 Chemical carcinogenesis - reactive oxygen species
    101527518
   05203 Viral carcinogenesis
    101527518
   05231 Choline metabolism in cancer
    101527518
  09162 Cancer: specific types
   05210 Colorectal cancer
    101527518
   05212 Pancreatic cancer
    101527518
   05211 Renal cell carcinoma
    101527518
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101527518
   05163 Human cytomegalovirus infection
    101527518
   05167 Kaposi sarcoma-associated herpesvirus infection
    101527518
   05169 Epstein-Barr virus infection
    101527518
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101527518
   05135 Yersinia infection
    101527518
   05100 Bacterial invasion of epithelial cells
    101527518
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    101527518
   05020 Prion disease
    101527518
   05022 Pathways of neurodegeneration - multiple diseases
    101527518
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101527518
   05418 Fluid shear stress and atherosclerosis
    101527518
   05415 Diabetic cardiomyopathy
    101527518
   05416 Viral myocarditis
    101527518
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101527518
   04933 AGE-RAGE signaling pathway in diabetic complications
    101527518
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:opi04131]
    101527518
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:opi04147]
    101527518
   04031 GTP-binding proteins [BR:opi04031]
    101527518
Membrane trafficking [BR:opi04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    101527518
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    101527518
  Macropinocytosis
   Ras GTPases
    101527518
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    101527518
Exosome [BR:opi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101527518
  Exosomal proteins of other body fluids (saliva and urine)
   101527518
  Exosomal proteins of colorectal cancer cells
   101527518
  Exosomal proteins of bladder cancer cells
   101527518
GTP-binding proteins [BR:opi04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    101527518
SSDB
Motif
Pfam: Ras Roc Arf
Other DBs
NCBI-GeneID: 101527518
NCBI-ProteinID: XP_036349317
LinkDB
Position
8:36361390..36361707
AA seq 105 aa
MQAIKCVVVGEGAVGKTCLLISYTTNVFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYGQLRPLSYPQMDVFLICFSLVSPASFENVHAKWYPEVRHHC
NT seq 315 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgcgtggtggtcggcgagggcgccgtgggcaagacgtgcctgctc
atcagctacacgaccaacgtgttcccgggagagtacatccccaccgtctttgacaactac
tcggccaacgtgatggtggatggcaagccggtcaaccttgggctgtgggacacggcgggg
caggaggactatggccagctgcgacccctctcctacccgcagatggacgtctttctgatt
tgcttttccctggtgagcccggcctccttcgagaacgtccacgccaagtggtacccggag
gtgcggcaccactgt

DBGET integrated database retrieval system