Ochotona princeps (American pika): 101528185 Help Entry 101528185         CDS       T07609                                  Name (RefSeq) profilin-1-like   KO K05759   profilin Organism opi  Ochotona princeps (American pika) Pathway opi04015   Rap1 signaling pathway opi04810   Regulation of actin cytoskeleton opi05014   Amyotrophic lateral sclerosis opi05132   Salmonella infection Brite KEGG Orthology (KO) [BR:opi00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     101528185  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     101528185  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101528185   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     101528185  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:opi04131]     101528185   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:opi04812]     101528185    04147 Exosome [BR:opi04147]     101528185 Membrane trafficking [BR:opi04131]  Others   Actin-binding proteins    Others     101528185 Cytoskeleton proteins [BR:opi04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      101528185 Exosome [BR:opi04147]  Exosomal proteins   Proteins found in most exosomes    101528185 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  101528185 NCBI-ProteinID:  XP_036349194 LinkDB All DBs Position 7:104986167..104986850 Genome browser AA seq 140 aa AA seqDB search MAGWNAYIDNLLADGTCQDAAIVGYKDSPSVWAAVPGKTFVNIMPAEVGVLVGQDWSSFF VNGLTLGGQKCSVIRDSRLQDGEFTMDFRTKSGSGVPTFNVTVTMTAKTLVLLMGKEGVH GGLINKKCYEMASYLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctacatcgacaacctcctggcagatgggacctgtcaggacgcg gccatcgtaggctacaaggactcaccctcggtctgggccgctgtgccgggcaaaaccttc gtcaacatcatgccagctgaggttggtgtcctggttggccaagactggtcaagcttcttt gtgaatgggctgacacttgggggccagaagtgctcagtgattcgggactcgcggctacaa gatggggagttcaccatggattttcgcaccaagagtggcagcggggtgcccaccttcaat gttactgtcaccatgactgccaagacgctagtcctactgatgggcaaagaaggtgtccat ggcggtttgatcaacaagaaatgttatgaaatggcctcctacctgcggcgttcccagtac tga

DBGET integrated database retrieval system