Ochotona princeps (American pika): 101528843 Help Entry 101528843         CDS       T07609                                  Name (RefSeq) histone H3.3A   KO K11253   histone H3 Organism opi  Ochotona princeps (American pika) Pathway opi04613   Neutrophil extracellular trap formation opi05034   Alcoholism opi05202   Transcriptional misregulation in cancer opi05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:opi00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101528843  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     101528843   09163 Immune disease    05322 Systemic lupus erythematosus     101528843   09165 Substance dependence    05034 Alcoholism     101528843  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:opi03036]     101528843   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:opi04147]     101528843 Chromosome and associated proteins [BR:opi03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101528843 Exosome [BR:opi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101528843 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  101528843 NCBI-ProteinID:  XP_004578655 LinkDB All DBs Position 16:33367697..33376448 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagactgcccgcaaatcgactggtggcaaagcacccagaaaacaa ctggctacaaaagccgctcgcaaaagtgcgccctctactggaggggtgaagaaacctcac cgttacaggcctggtactgtggcgctccgtgaaattagacgttatcagaagtccactgag cttctgattcgcaaactccccttccaacgtctggtgcgagaaattgctcaggatttcaaa acagatctgcgcttccagagtgcagctattggtgctttgcaggaggcaagtgaggcctat ctggttggcctgtttgaagacaccaacctgtgtgctatccatgccaaacgtgtaacaatt atgccaaaagacatccagctagcacgccgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system