Ochotona princeps (American pika): 101529186 Help Entry 101529186         CDS       T07609                                  Symbol CCL22 Name (RefSeq) C-C motif chemokine 22   KO K21095   C-C motif chemokine 22 Organism opi  Ochotona princeps (American pika) Pathway opi04060   Cytokine-cytokine receptor interaction opi04061   Viral protein interaction with cytokine and cytokine receptor opi04062   Chemokine signaling pathway opi04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:opi00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101529186 (CCL22)    04061 Viral protein interaction with cytokine and cytokine receptor     101529186 (CCL22)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101529186 (CCL22)    04062 Chemokine signaling pathway     101529186 (CCL22)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:opi04052]     101529186 (CCL22) Cytokines and neuropeptides [BR:opi04052]  Cytokines   Chemokines    101529186 (CCL22) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  101529186 NCBI-ProteinID:  XP_004583940 LinkDB All DBs Position 5:28920596..28924370 Genome browser AA seq 93 aa AA seqDB search MASLQASLLAAFILLAMVLQAAEAGPYGANVEDSVCCRDYVRRPLNLRVVKHFYLTSNSC RRPGVVLVTNRDLEICADPRMPWVKKILRKLDE NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggctagcctgcaagcctcactcctggctgccttcatcctccttgccatggtgctccag gctgcggaggcaggtccctatggtgccaacgtggaggacagcgtctgctgccgggattat gtgcgccgacccctaaatctgcgcgtggtcaagcatttctatttgacttccaactcctgc cggaggcctggcgtggtgttggtgaccaacagagacctggagatctgtgctgaccccagg atgccctgggtaaagaagatcctccgaaagctggatgaatga

DBGET integrated database retrieval system