Ochotona princeps (American pika): 101529298 Help Entry 101529298         CDS       T07609                                  Symbol CALML3 Name (RefSeq) calmodulin-like protein 3   KO K02183   calmodulin Organism opi  Ochotona princeps (American pika) Pathway opi04014   Ras signaling pathway opi04015   Rap1 signaling pathway opi04020   Calcium signaling pathway opi04022   cGMP-PKG signaling pathway opi04024   cAMP signaling pathway opi04070   Phosphatidylinositol signaling system opi04114   Oocyte meiosis opi04218   Cellular senescence opi04261   Adrenergic signaling in cardiomyocytes opi04270   Vascular smooth muscle contraction opi04371   Apelin signaling pathway opi04625   C-type lectin receptor signaling pathway opi04713   Circadian entrainment opi04720   Long-term potentiation opi04722   Neurotrophin signaling pathway opi04728   Dopaminergic synapse opi04740   Olfactory transduction opi04744   Phototransduction opi04750   Inflammatory mediator regulation of TRP channels opi04910   Insulin signaling pathway opi04912   GnRH signaling pathway opi04915   Estrogen signaling pathway opi04916   Melanogenesis opi04921   Oxytocin signaling pathway opi04922   Glucagon signaling pathway opi04924   Renin secretion opi04925   Aldosterone synthesis and secretion opi04970   Salivary secretion opi04971   Gastric acid secretion opi05010   Alzheimer disease opi05012   Parkinson disease opi05022   Pathways of neurodegeneration - multiple diseases opi05031   Amphetamine addiction opi05034   Alcoholism opi05133   Pertussis opi05152   Tuberculosis opi05163   Human cytomegalovirus infection opi05167   Kaposi sarcoma-associated herpesvirus infection opi05170   Human immunodeficiency virus 1 infection opi05200   Pathways in cancer opi05214   Glioma opi05417   Lipid and atherosclerosis opi05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:opi00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     101529298 (CALML3)    04015 Rap1 signaling pathway     101529298 (CALML3)    04371 Apelin signaling pathway     101529298 (CALML3)    04020 Calcium signaling pathway     101529298 (CALML3)    04070 Phosphatidylinositol signaling system     101529298 (CALML3)    04024 cAMP signaling pathway     101529298 (CALML3)    04022 cGMP-PKG signaling pathway     101529298 (CALML3)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     101529298 (CALML3)    04218 Cellular senescence     101529298 (CALML3)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101529298 (CALML3)   09152 Endocrine system    04910 Insulin signaling pathway     101529298 (CALML3)    04922 Glucagon signaling pathway     101529298 (CALML3)    04912 GnRH signaling pathway     101529298 (CALML3)    04915 Estrogen signaling pathway     101529298 (CALML3)    04921 Oxytocin signaling pathway     101529298 (CALML3)    04916 Melanogenesis     101529298 (CALML3)    04924 Renin secretion     101529298 (CALML3)    04925 Aldosterone synthesis and secretion     101529298 (CALML3)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     101529298 (CALML3)    04270 Vascular smooth muscle contraction     101529298 (CALML3)   09154 Digestive system    04970 Salivary secretion     101529298 (CALML3)    04971 Gastric acid secretion     101529298 (CALML3)   09156 Nervous system    04728 Dopaminergic synapse     101529298 (CALML3)    04720 Long-term potentiation     101529298 (CALML3)    04722 Neurotrophin signaling pathway     101529298 (CALML3)   09157 Sensory system    04744 Phototransduction     101529298 (CALML3)    04740 Olfactory transduction     101529298 (CALML3)    04750 Inflammatory mediator regulation of TRP channels     101529298 (CALML3)   09159 Environmental adaptation    04713 Circadian entrainment     101529298 (CALML3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101529298 (CALML3)   09162 Cancer: specific types    05214 Glioma     101529298 (CALML3)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     101529298 (CALML3)    05163 Human cytomegalovirus infection     101529298 (CALML3)    05167 Kaposi sarcoma-associated herpesvirus infection     101529298 (CALML3)   09171 Infectious disease: bacterial    05133 Pertussis     101529298 (CALML3)    05152 Tuberculosis     101529298 (CALML3)   09164 Neurodegenerative disease    05010 Alzheimer disease     101529298 (CALML3)    05012 Parkinson disease     101529298 (CALML3)    05022 Pathways of neurodegeneration - multiple diseases     101529298 (CALML3)   09165 Substance dependence    05031 Amphetamine addiction     101529298 (CALML3)    05034 Alcoholism     101529298 (CALML3)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101529298 (CALML3)    05418 Fluid shear stress and atherosclerosis     101529298 (CALML3)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:opi01009]     101529298 (CALML3)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:opi04131]     101529298 (CALML3)    03036 Chromosome and associated proteins [BR:opi03036]     101529298 (CALML3)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:opi04147]     101529298 (CALML3) Protein phosphatases and associated proteins [BR:opi01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      101529298 (CALML3) Membrane trafficking [BR:opi04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     101529298 (CALML3) Chromosome and associated proteins [BR:opi03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      101529298 (CALML3) Exosome [BR:opi04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    101529298 (CALML3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 AIF-1 UPF0154 EF_EFCAB10_C EH SPARC_Ca_bdg EFhand_Ca_insen Dockerin_1 DUF5580_M EF-hand_11 FCaBP_EF-hand Caleosin SurA_N_3 SurA_N_2 Phosphorylase SPEF2_C Motif Other DBs NCBI-GeneID:  101529298 NCBI-ProteinID:  XP_004588547 LinkDB All DBs Position 16:complement(64468963..64469415) Genome browser AA seq 149 aa AA seqDB search MADQLTEEQVATFKEAFSLFDKDGDGSITTQELGTVMRSLGQNPTEAELQDMVREIDRDG SGTVDFSEFLGMMVRQMKDTHSEEEIREAFRVFDKDGNGYVSAAELRHVMTRLGEKLSDE EVDEMIRSADIDGDGQVNYEEFVHMLLSK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggctgaccagctgactgaggaacaggtagccactttcaaggaggctttctctctgttt gacaaggatggagacggcagcatcaccacccaggagctgggtactgtcatgaggtccctg ggccagaaccctaccgaggcggaactccaggacatggtgagagagattgacagggatggc agtggcactgtggacttctctgagttcctgggcatgatggtcaggcagatgaaggacacg catagtgaggaggagatccgggaagccttccgcgtgtttgacaaagatggtaatggctat gtcagtgctgctgagctgagacacgtgatgaccaggttaggagagaagctgagcgacgag gaagtggacgaaatgatccggtcagcagacatagatggagacggacaggtgaactacgag gagtttgtccatatgctgctgtctaagtaa

DBGET integrated database retrieval system