Ochotona princeps (American pika): 101529630 Help Entry 101529630         CDS       T07609                                  Name (RefSeq) histone H3.3A   KO K11253   histone H3 Organism opi  Ochotona princeps (American pika) Pathway opi04613   Neutrophil extracellular trap formation opi05034   Alcoholism opi05202   Transcriptional misregulation in cancer opi05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:opi00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101529630  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     101529630   09163 Immune disease    05322 Systemic lupus erythematosus     101529630   09165 Substance dependence    05034 Alcoholism     101529630  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:opi03036]     101529630   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:opi04147]     101529630 Chromosome and associated proteins [BR:opi03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101529630 Exosome [BR:opi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101529630 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  101529630 NCBI-ProteinID:  XP_004592960 LinkDB All DBs Position 19:3590956..3592670 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcccggaccaagcagactgcgcgcaagtccaccggaggcaaagccccccgcaaacag ctggccacgaaggctgcccggaaaagcgctccctcgaccggcggcgtgaagaagccgcat cgctacaggcccggcaccgtggcgctccgggagatccgccgttaccagaagtcgacggag ctgctgatccggaagctgcccttccagcggctggtgcgggagatcgcgcaggacttcaag acggacctgcggttccagagcgcggccatcggcgcgctgcaggaggccagcgaggcgtac ctggtgggtctgttcgaggacacgaacctgtgcgccatccacgccaagagagtgaccatc atgcccaaagacatccagctggctcgccggatacggggagagcgagcttga

DBGET integrated database retrieval system