KEGG   Ochotona princeps (American pika): 101530701
Entry
101530701         CDS       T07609                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3 isoform X1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
opi  Ochotona princeps (American pika)
Pathway
opi01521  EGFR tyrosine kinase inhibitor resistance
opi01522  Endocrine resistance
opi01524  Platinum drug resistance
opi04010  MAPK signaling pathway
opi04012  ErbB signaling pathway
opi04014  Ras signaling pathway
opi04015  Rap1 signaling pathway
opi04022  cGMP-PKG signaling pathway
opi04024  cAMP signaling pathway
opi04062  Chemokine signaling pathway
opi04066  HIF-1 signaling pathway
opi04068  FoxO signaling pathway
opi04071  Sphingolipid signaling pathway
opi04072  Phospholipase D signaling pathway
opi04114  Oocyte meiosis
opi04140  Autophagy - animal
opi04148  Efferocytosis
opi04150  mTOR signaling pathway
opi04151  PI3K-Akt signaling pathway
opi04210  Apoptosis
opi04218  Cellular senescence
opi04261  Adrenergic signaling in cardiomyocytes
opi04270  Vascular smooth muscle contraction
opi04350  TGF-beta signaling pathway
opi04360  Axon guidance
opi04370  VEGF signaling pathway
opi04371  Apelin signaling pathway
opi04380  Osteoclast differentiation
opi04510  Focal adhesion
opi04517  IgSF CAM signaling
opi04520  Adherens junction
opi04540  Gap junction
opi04550  Signaling pathways regulating pluripotency of stem cells
opi04611  Platelet activation
opi04613  Neutrophil extracellular trap formation
opi04620  Toll-like receptor signaling pathway
opi04621  NOD-like receptor signaling pathway
opi04625  C-type lectin receptor signaling pathway
opi04650  Natural killer cell mediated cytotoxicity
opi04657  IL-17 signaling pathway
opi04658  Th1 and Th2 cell differentiation
opi04659  Th17 cell differentiation
opi04660  T cell receptor signaling pathway
opi04662  B cell receptor signaling pathway
opi04664  Fc epsilon RI signaling pathway
opi04666  Fc gamma R-mediated phagocytosis
opi04668  TNF signaling pathway
opi04713  Circadian entrainment
opi04720  Long-term potentiation
opi04722  Neurotrophin signaling pathway
opi04723  Retrograde endocannabinoid signaling
opi04724  Glutamatergic synapse
opi04725  Cholinergic synapse
opi04726  Serotonergic synapse
opi04730  Long-term depression
opi04810  Regulation of actin cytoskeleton
opi04910  Insulin signaling pathway
opi04912  GnRH signaling pathway
opi04914  Progesterone-mediated oocyte maturation
opi04915  Estrogen signaling pathway
opi04916  Melanogenesis
opi04917  Prolactin signaling pathway
opi04919  Thyroid hormone signaling pathway
opi04921  Oxytocin signaling pathway
opi04926  Relaxin signaling pathway
opi04928  Parathyroid hormone synthesis, secretion and action
opi04929  GnRH secretion
opi04930  Type II diabetes mellitus
opi04933  AGE-RAGE signaling pathway in diabetic complications
opi04934  Cushing syndrome
opi04935  Growth hormone synthesis, secretion and action
opi04960  Aldosterone-regulated sodium reabsorption
opi05010  Alzheimer disease
opi05020  Prion disease
opi05022  Pathways of neurodegeneration - multiple diseases
opi05034  Alcoholism
opi05132  Salmonella infection
opi05133  Pertussis
opi05135  Yersinia infection
opi05140  Leishmaniasis
opi05142  Chagas disease
opi05145  Toxoplasmosis
opi05152  Tuberculosis
opi05160  Hepatitis C
opi05161  Hepatitis B
opi05163  Human cytomegalovirus infection
opi05164  Influenza A
opi05165  Human papillomavirus infection
opi05166  Human T-cell leukemia virus 1 infection
opi05167  Kaposi sarcoma-associated herpesvirus infection
opi05170  Human immunodeficiency virus 1 infection
opi05171  Coronavirus disease - COVID-19
opi05200  Pathways in cancer
opi05203  Viral carcinogenesis
opi05205  Proteoglycans in cancer
opi05206  MicroRNAs in cancer
opi05207  Chemical carcinogenesis - receptor activation
opi05208  Chemical carcinogenesis - reactive oxygen species
opi05210  Colorectal cancer
opi05211  Renal cell carcinoma
opi05212  Pancreatic cancer
opi05213  Endometrial cancer
opi05214  Glioma
opi05215  Prostate cancer
opi05216  Thyroid cancer
opi05218  Melanoma
opi05219  Bladder cancer
opi05220  Chronic myeloid leukemia
opi05221  Acute myeloid leukemia
opi05223  Non-small cell lung cancer
opi05224  Breast cancer
opi05225  Hepatocellular carcinoma
opi05226  Gastric cancer
opi05230  Central carbon metabolism in cancer
opi05231  Choline metabolism in cancer
opi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
opi05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:opi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101530701 (MAPK3)
   04012 ErbB signaling pathway
    101530701 (MAPK3)
   04014 Ras signaling pathway
    101530701 (MAPK3)
   04015 Rap1 signaling pathway
    101530701 (MAPK3)
   04350 TGF-beta signaling pathway
    101530701 (MAPK3)
   04370 VEGF signaling pathway
    101530701 (MAPK3)
   04371 Apelin signaling pathway
    101530701 (MAPK3)
   04668 TNF signaling pathway
    101530701 (MAPK3)
   04066 HIF-1 signaling pathway
    101530701 (MAPK3)
   04068 FoxO signaling pathway
    101530701 (MAPK3)
   04072 Phospholipase D signaling pathway
    101530701 (MAPK3)
   04071 Sphingolipid signaling pathway
    101530701 (MAPK3)
   04024 cAMP signaling pathway
    101530701 (MAPK3)
   04022 cGMP-PKG signaling pathway
    101530701 (MAPK3)
   04151 PI3K-Akt signaling pathway
    101530701 (MAPK3)
   04150 mTOR signaling pathway
    101530701 (MAPK3)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    101530701 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101530701 (MAPK3)
   04148 Efferocytosis
    101530701 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    101530701 (MAPK3)
   04210 Apoptosis
    101530701 (MAPK3)
   04218 Cellular senescence
    101530701 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101530701 (MAPK3)
   04520 Adherens junction
    101530701 (MAPK3)
   04540 Gap junction
    101530701 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    101530701 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101530701 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101530701 (MAPK3)
   04613 Neutrophil extracellular trap formation
    101530701 (MAPK3)
   04620 Toll-like receptor signaling pathway
    101530701 (MAPK3)
   04621 NOD-like receptor signaling pathway
    101530701 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    101530701 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    101530701 (MAPK3)
   04660 T cell receptor signaling pathway
    101530701 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    101530701 (MAPK3)
   04659 Th17 cell differentiation
    101530701 (MAPK3)
   04657 IL-17 signaling pathway
    101530701 (MAPK3)
   04662 B cell receptor signaling pathway
    101530701 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    101530701 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    101530701 (MAPK3)
   04062 Chemokine signaling pathway
    101530701 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101530701 (MAPK3)
   04929 GnRH secretion
    101530701 (MAPK3)
   04912 GnRH signaling pathway
    101530701 (MAPK3)
   04915 Estrogen signaling pathway
    101530701 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    101530701 (MAPK3)
   04917 Prolactin signaling pathway
    101530701 (MAPK3)
   04921 Oxytocin signaling pathway
    101530701 (MAPK3)
   04926 Relaxin signaling pathway
    101530701 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    101530701 (MAPK3)
   04919 Thyroid hormone signaling pathway
    101530701 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    101530701 (MAPK3)
   04916 Melanogenesis
    101530701 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101530701 (MAPK3)
   04270 Vascular smooth muscle contraction
    101530701 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101530701 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    101530701 (MAPK3)
   04725 Cholinergic synapse
    101530701 (MAPK3)
   04726 Serotonergic synapse
    101530701 (MAPK3)
   04720 Long-term potentiation
    101530701 (MAPK3)
   04730 Long-term depression
    101530701 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    101530701 (MAPK3)
   04722 Neurotrophin signaling pathway
    101530701 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    101530701 (MAPK3)
   04380 Osteoclast differentiation
    101530701 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101530701 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101530701 (MAPK3)
   05206 MicroRNAs in cancer
    101530701 (MAPK3)
   05205 Proteoglycans in cancer
    101530701 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    101530701 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    101530701 (MAPK3)
   05203 Viral carcinogenesis
    101530701 (MAPK3)
   05230 Central carbon metabolism in cancer
    101530701 (MAPK3)
   05231 Choline metabolism in cancer
    101530701 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101530701 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101530701 (MAPK3)
   05212 Pancreatic cancer
    101530701 (MAPK3)
   05225 Hepatocellular carcinoma
    101530701 (MAPK3)
   05226 Gastric cancer
    101530701 (MAPK3)
   05214 Glioma
    101530701 (MAPK3)
   05216 Thyroid cancer
    101530701 (MAPK3)
   05221 Acute myeloid leukemia
    101530701 (MAPK3)
   05220 Chronic myeloid leukemia
    101530701 (MAPK3)
   05218 Melanoma
    101530701 (MAPK3)
   05211 Renal cell carcinoma
    101530701 (MAPK3)
   05219 Bladder cancer
    101530701 (MAPK3)
   05215 Prostate cancer
    101530701 (MAPK3)
   05213 Endometrial cancer
    101530701 (MAPK3)
   05224 Breast cancer
    101530701 (MAPK3)
   05223 Non-small cell lung cancer
    101530701 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101530701 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    101530701 (MAPK3)
   05161 Hepatitis B
    101530701 (MAPK3)
   05160 Hepatitis C
    101530701 (MAPK3)
   05171 Coronavirus disease - COVID-19
    101530701 (MAPK3)
   05164 Influenza A
    101530701 (MAPK3)
   05163 Human cytomegalovirus infection
    101530701 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101530701 (MAPK3)
   05165 Human papillomavirus infection
    101530701 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101530701 (MAPK3)
   05135 Yersinia infection
    101530701 (MAPK3)
   05133 Pertussis
    101530701 (MAPK3)
   05152 Tuberculosis
    101530701 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101530701 (MAPK3)
   05140 Leishmaniasis
    101530701 (MAPK3)
   05142 Chagas disease
    101530701 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101530701 (MAPK3)
   05020 Prion disease
    101530701 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    101530701 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    101530701 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101530701 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101530701 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101530701 (MAPK3)
   04934 Cushing syndrome
    101530701 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101530701 (MAPK3)
   01524 Platinum drug resistance
    101530701 (MAPK3)
   01522 Endocrine resistance
    101530701 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:opi01001]
    101530701 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:opi03036]
    101530701 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:opi04147]
    101530701 (MAPK3)
Enzymes [BR:opi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101530701 (MAPK3)
Protein kinases [BR:opi01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101530701 (MAPK3)
Chromosome and associated proteins [BR:opi03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     101530701 (MAPK3)
Exosome [BR:opi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101530701 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 101530701
NCBI-ProteinID: XP_012782967
LinkDB
Position
6:23272459..23278887
AA seq 281 aa
MVSSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLDA
MRDVYIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLI
NTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCI
LAEMLSNRPIFPGKHYLDQLNHILALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTD
EPVAEEPFTFDMELDDLPKERLKELIFQETARFQPGAPECP
NT seq 846 nt   +upstreamnt  +downstreamnt
atggtcagctcggcctatgaccacgtgcgtaagacccgcgtggccatcaagaagatcagc
cccttcgagcaccagacctactgccagcgcacgctgcgcgagatccagatcctactgcgc
ttccgccacgagaacgtcatcggcatccgggacatcctccgcgcgcccaccctggacgcc
atgagggatgtctacatcgtgcaggacctgatggagactgacctgtacaagttgctcaaa
agccagcagctgagcaatgaccacatctgctacttcctctaccagatcctgcggggcctc
aagtacatccactcggccaatgtgctacaccgggacctgaagccctccaacctgctcatc
aataccacctgtgaccttaagatctgcgactttggtctggcccgcatcgcagaccctgag
cacgaccacactggctttctgacggagtacgtggccacacgctggtaccgggccccagag
atcatgctgaactccaagggctataccaagtccatcgacatctggtctgtgggctgcatc
ctggctgagatgctctccaatcggcctatcttccctggcaagcactacctggaccaactc
aaccacattctagcccttgacctgctggaccggatgttaaccttcaaccccaacaagcgg
atcacggtggaggaagcgctggctcacccctatctggagcagtactatgacccaacagat
gagcctgtggccgaggagcccttcaccttcgacatggagctggatgatctccccaaggag
cggctgaaggagctcatcttccaggaaacggcccgcttccagcctggggccccggagtgc
ccctag

DBGET integrated database retrieval system