Ochotona princeps (American pika): 101530901 Help Entry 101530901         CDS       T07609                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism opi  Ochotona princeps (American pika) Pathway opi04613   Neutrophil extracellular trap formation opi05034   Alcoholism opi05203   Viral carcinogenesis opi05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:opi00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101530901  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     101530901   09163 Immune disease    05322 Systemic lupus erythematosus     101530901   09165 Substance dependence    05034 Alcoholism     101530901  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:opi03036]     101530901 Chromosome and associated proteins [BR:opi03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101530901 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  101530901 NCBI-ProteinID:  XP_004598447 LinkDB All DBs Position 12:26455794..26456157 Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgtggcaagggaggcaaaggccttggcaaaggcggtgccaagcgccaccgc aaggtgctgcgcgacaacatccagggcatcaccaagcccgccatccgccgcctggcgcgc cgcggcggcgtcaagcgcatctcgggcctcatctacgaggagacccgcggcgtgctcaag gtcttcctggagaacgtcatccgcgacgccgtcacctacacggagcacgccaagcgcaag acggtcacggccatggacgtggtctacgcgctcaagcgccagggccgcaccctctacggc ttcggcggctaa

DBGET integrated database retrieval system