Ochotona princeps (American pika): 101531636 Help Entry 101531636         CDS       T07609                                  Symbol HRAS Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism opi  Ochotona princeps (American pika) Pathway opi01521   EGFR tyrosine kinase inhibitor resistance opi01522   Endocrine resistance opi04010   MAPK signaling pathway opi04012   ErbB signaling pathway opi04014   Ras signaling pathway opi04015   Rap1 signaling pathway opi04062   Chemokine signaling pathway opi04068   FoxO signaling pathway opi04071   Sphingolipid signaling pathway opi04072   Phospholipase D signaling pathway opi04137   Mitophagy - animal opi04140   Autophagy - animal opi04144   Endocytosis opi04150   mTOR signaling pathway opi04151   PI3K-Akt signaling pathway opi04210   Apoptosis opi04211   Longevity regulating pathway opi04213   Longevity regulating pathway - multiple species opi04218   Cellular senescence opi04360   Axon guidance opi04370   VEGF signaling pathway opi04371   Apelin signaling pathway opi04510   Focal adhesion opi04540   Gap junction opi04550   Signaling pathways regulating pluripotency of stem cells opi04625   C-type lectin receptor signaling pathway opi04630   JAK-STAT signaling pathway opi04650   Natural killer cell mediated cytotoxicity opi04660   T cell receptor signaling pathway opi04662   B cell receptor signaling pathway opi04664   Fc epsilon RI signaling pathway opi04714   Thermogenesis opi04720   Long-term potentiation opi04722   Neurotrophin signaling pathway opi04725   Cholinergic synapse opi04726   Serotonergic synapse opi04730   Long-term depression opi04810   Regulation of actin cytoskeleton opi04910   Insulin signaling pathway opi04912   GnRH signaling pathway opi04915   Estrogen signaling pathway opi04916   Melanogenesis opi04917   Prolactin signaling pathway opi04919   Thyroid hormone signaling pathway opi04921   Oxytocin signaling pathway opi04926   Relaxin signaling pathway opi04929   GnRH secretion opi04933   AGE-RAGE signaling pathway in diabetic complications opi04935   Growth hormone synthesis, secretion and action opi05010   Alzheimer disease opi05022   Pathways of neurodegeneration - multiple diseases opi05034   Alcoholism opi05132   Salmonella infection opi05160   Hepatitis C opi05161   Hepatitis B opi05163   Human cytomegalovirus infection opi05165   Human papillomavirus infection opi05166   Human T-cell leukemia virus 1 infection opi05167   Kaposi sarcoma-associated herpesvirus infection opi05170   Human immunodeficiency virus 1 infection opi05200   Pathways in cancer opi05203   Viral carcinogenesis opi05205   Proteoglycans in cancer opi05206   MicroRNAs in cancer opi05207   Chemical carcinogenesis - receptor activation opi05208   Chemical carcinogenesis - reactive oxygen species opi05210   Colorectal cancer opi05211   Renal cell carcinoma opi05213   Endometrial cancer opi05214   Glioma opi05215   Prostate cancer opi05216   Thyroid cancer opi05218   Melanoma opi05219   Bladder cancer opi05220   Chronic myeloid leukemia opi05221   Acute myeloid leukemia opi05223   Non-small cell lung cancer opi05224   Breast cancer opi05225   Hepatocellular carcinoma opi05226   Gastric cancer opi05230   Central carbon metabolism in cancer opi05231   Choline metabolism in cancer opi05235   PD-L1 expression and PD-1 checkpoint pathway in cancer opi05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:opi00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101531636 (HRAS)    04012 ErbB signaling pathway     101531636 (HRAS)    04014 Ras signaling pathway     101531636 (HRAS)    04015 Rap1 signaling pathway     101531636 (HRAS)    04370 VEGF signaling pathway     101531636 (HRAS)    04371 Apelin signaling pathway     101531636 (HRAS)    04630 JAK-STAT signaling pathway     101531636 (HRAS)    04068 FoxO signaling pathway     101531636 (HRAS)    04072 Phospholipase D signaling pathway     101531636 (HRAS)    04071 Sphingolipid signaling pathway     101531636 (HRAS)    04151 PI3K-Akt signaling pathway     101531636 (HRAS)    04150 mTOR signaling pathway     101531636 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     101531636 (HRAS)    04140 Autophagy - animal     101531636 (HRAS)    04137 Mitophagy - animal     101531636 (HRAS)   09143 Cell growth and death    04210 Apoptosis     101531636 (HRAS)    04218 Cellular senescence     101531636 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     101531636 (HRAS)    04540 Gap junction     101531636 (HRAS)    04550 Signaling pathways regulating pluripotency of stem cells     101531636 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     101531636 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101531636 (HRAS)    04650 Natural killer cell mediated cytotoxicity     101531636 (HRAS)    04660 T cell receptor signaling pathway     101531636 (HRAS)    04662 B cell receptor signaling pathway     101531636 (HRAS)    04664 Fc epsilon RI signaling pathway     101531636 (HRAS)    04062 Chemokine signaling pathway     101531636 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     101531636 (HRAS)    04929 GnRH secretion     101531636 (HRAS)    04912 GnRH signaling pathway     101531636 (HRAS)    04915 Estrogen signaling pathway     101531636 (HRAS)    04917 Prolactin signaling pathway     101531636 (HRAS)    04921 Oxytocin signaling pathway     101531636 (HRAS)    04926 Relaxin signaling pathway     101531636 (HRAS)    04935 Growth hormone synthesis, secretion and action     101531636 (HRAS)    04919 Thyroid hormone signaling pathway     101531636 (HRAS)    04916 Melanogenesis     101531636 (HRAS)   09156 Nervous system    04725 Cholinergic synapse     101531636 (HRAS)    04726 Serotonergic synapse     101531636 (HRAS)    04720 Long-term potentiation     101531636 (HRAS)    04730 Long-term depression     101531636 (HRAS)    04722 Neurotrophin signaling pathway     101531636 (HRAS)   09158 Development and regeneration    04360 Axon guidance     101531636 (HRAS)   09149 Aging    04211 Longevity regulating pathway     101531636 (HRAS)    04213 Longevity regulating pathway - multiple species     101531636 (HRAS)   09159 Environmental adaptation    04714 Thermogenesis     101531636 (HRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101531636 (HRAS)    05206 MicroRNAs in cancer     101531636 (HRAS)    05205 Proteoglycans in cancer     101531636 (HRAS)    05207 Chemical carcinogenesis - receptor activation     101531636 (HRAS)    05208 Chemical carcinogenesis - reactive oxygen species     101531636 (HRAS)    05203 Viral carcinogenesis     101531636 (HRAS)    05230 Central carbon metabolism in cancer     101531636 (HRAS)    05231 Choline metabolism in cancer     101531636 (HRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     101531636 (HRAS)   09162 Cancer: specific types    05210 Colorectal cancer     101531636 (HRAS)    05225 Hepatocellular carcinoma     101531636 (HRAS)    05226 Gastric cancer     101531636 (HRAS)    05214 Glioma     101531636 (HRAS)    05216 Thyroid cancer     101531636 (HRAS)    05221 Acute myeloid leukemia     101531636 (HRAS)    05220 Chronic myeloid leukemia     101531636 (HRAS)    05218 Melanoma     101531636 (HRAS)    05211 Renal cell carcinoma     101531636 (HRAS)    05219 Bladder cancer     101531636 (HRAS)    05215 Prostate cancer     101531636 (HRAS)    05213 Endometrial cancer     101531636 (HRAS)    05224 Breast cancer     101531636 (HRAS)    05223 Non-small cell lung cancer     101531636 (HRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101531636 (HRAS)    05170 Human immunodeficiency virus 1 infection     101531636 (HRAS)    05161 Hepatitis B     101531636 (HRAS)    05160 Hepatitis C     101531636 (HRAS)    05163 Human cytomegalovirus infection     101531636 (HRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     101531636 (HRAS)    05165 Human papillomavirus infection     101531636 (HRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     101531636 (HRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     101531636 (HRAS)    05022 Pathways of neurodegeneration - multiple diseases     101531636 (HRAS)   09165 Substance dependence    05034 Alcoholism     101531636 (HRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101531636 (HRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     101531636 (HRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     101531636 (HRAS)    01522 Endocrine resistance     101531636 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:opi04131]     101531636 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:opi04147]     101531636 (HRAS)    04031 GTP-binding proteins [BR:opi04031]     101531636 (HRAS) Membrane trafficking [BR:opi04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     101531636 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     101531636 (HRAS) Exosome [BR:opi04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    101531636 (HRAS)   Exosomal proteins of colorectal cancer cells    101531636 (HRAS) GTP-binding proteins [BR:opi04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     101531636 (HRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N CdhD AAA_16 Motif Other DBs NCBI-GeneID:  101531636 NCBI-ProteinID:  XP_004599258 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDVHQYREQIKRVKDSDDVPMVLVGNKCDL AARTVESRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPEEGGRG CLSCKCVLS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtataagctggtggtcgtgggcgccgggggcgtgggcaagagcgcgctgacc atccagctaatccagaaccactttgtggacgaatatgaccccaccatagaggactcatac cggaagcaggtggtcatcgatggggagacgtgcctgctggacattctggacacggctggc caggaagagtacagtgccatgcgggaccagtacatgcgcacgggagagggcttcctttgc gtgttcgccatcaacaacaccaaatccttcgaggacgtccaccagtacagggagcagatc aagagggtgaaggactcagacgacgtgcccatggtgctggtggggaacaaatgtgacttg gcggcacgcacggtggagtcccggcaggcccaggaactggcccgcagctacggcatcccc tacattgagacgtcggccaagacccggcagggcgtggaggacgccttctacacgctggtg cgcgagatcaggcagcataagctacgcaagctgaacccgcctgaggagggcggccgcggc tgcctgagctgcaagtgtgtgctgtcctga

DBGET integrated database retrieval system