Ochotona princeps (American pika): 101531767 Help Entry 101531767         CDS       T07609                                  Name (RefSeq) profilin-1-like   KO K05759   profilin Organism opi  Ochotona princeps (American pika) Pathway opi04015   Rap1 signaling pathway opi04810   Regulation of actin cytoskeleton opi05014   Amyotrophic lateral sclerosis opi05132   Salmonella infection Brite KEGG Orthology (KO) [BR:opi00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     101531767  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     101531767  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101531767   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     101531767  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:opi04131]     101531767   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:opi04812]     101531767    04147 Exosome [BR:opi04147]     101531767 Membrane trafficking [BR:opi04131]  Others   Actin-binding proteins    Others     101531767 Cytoskeleton proteins [BR:opi04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      101531767 Exosome [BR:opi04147]  Exosomal proteins   Proteins found in most exosomes    101531767 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Pombe_5TM Motif Other DBs NCBI-GeneID:  101531767 NCBI-ProteinID:  XP_036350409 LinkDB All DBs Position 1:106497714..106498398 Genome browser AA seq 140 aa AA seqDB search MAGWNAYIDNLMADGTCQDGAIVGYKDSPLVWATMPGKTFVNITPAEVGVLVGQDWSSFF VNGLTLGGQKCSVIRDSLLQDGEFTMDLHTKSGSGAPTFNVTVTMTAKTLVLLMGKEGVH GGLINKKCYEMASHLRHSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctacatcgacaacctcatggcggatgggacctgtcaggacggg gccatcgtaggctacaaggactcgcccttggtctgggccaccatgccaggcaaaaccttc gtcaacatcacgccagctgaggttggtgtcctggttggccaagactggtcaagtttcttt gtgaatgggctgacacttgggggccagaagtgctcggtgattcgggactcgctgctacaa gatggggagttcaccatggatcttcacaccaagagtggcagcggggcacccaccttcaat gtcactgtcaccatgactgccaagacgctagtcctactgatgggcaaagaaggtgtccat ggcggtttgatcaacaagaaatgttatgaaatggcctcccacctgcggcattcccagtac tga

DBGET integrated database retrieval system