Ochotona princeps (American pika): 101531777 Help Entry 101531777         CDS       T07609                                  Name (RefSeq) thioredoxin-like   KO K03671   thioredoxin Organism opi  Ochotona princeps (American pika) Pathway opi04621   NOD-like receptor signaling pathway opi05012   Parkinson disease opi05132   Salmonella infection opi05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:opi00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     101531777  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101531777   09164 Neurodegenerative disease    05012 Parkinson disease     101531777   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     101531777  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:opi03110]     101531777 Chaperones and folding catalysts [BR:opi03110]  Protein folding catalysts   Protein disulfide isomerase    101531777 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 OST3_OST6 DIM1 AhpC-TSA Thioredoxin_2 Thioredoxin_9 Glutaredoxin Motif Other DBs NCBI-GeneID:  101531777 NCBI-ProteinID:  XP_012784561 LinkDB All DBs Position 17:79275162..79275617 Genome browser AA seq 105 aa AA seqDB search MVKQIESKPAFQEVLDSAGDKLVVVNFSATCCGPCKMIKPFFHSLSEKYSNVLFIEVDVD DCQDIAADCEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELL NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaaacagattgagagcaagcccgcttttcaggaagtgttggactctgcaggagat aagctagttgtggttaacttctcagccacgtgctgcggaccctgcaagatgatcaagcca ttctttcattccctctctgaaaaatattccaacgtgctgtttattgaagtagatgtggat gactgccaggatatcgctgcagactgtgaagtcaagtgcatgcccaccttccagtttttt aagaagggccagaaggtgggtgaattttctggagcaaataaggaaaaacttgaagccacc attaatgaactactttaa

DBGET integrated database retrieval system