Ochotona princeps (American pika): 101532535 Help Entry 101532535         CDS       T07609                                  Name (RefSeq) histone H2B type 3-B   KO K11252   histone H2B Organism opi  Ochotona princeps (American pika) Pathway opi04613   Neutrophil extracellular trap formation opi05034   Alcoholism opi05203   Viral carcinogenesis opi05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:opi00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101532535  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     101532535   09163 Immune disease    05322 Systemic lupus erythematosus     101532535   09165 Substance dependence    05034 Alcoholism     101532535  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:opi03036]     101532535   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:opi04147]     101532535 Chromosome and associated proteins [BR:opi03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101532535 Exosome [BR:opi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101532535 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa ARM_TT21 LonB_AAA-LID CENP-T_C Motif Other DBs NCBI-GeneID:  101532535 NCBI-ProteinID:  XP_004586398 LinkDB All DBs Position 3A:52645665..52646116 Genome browser AA seq 126 aa AA seqDB search MPDPSRSAPAPKKGSKKAITKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgccggacccctctcgctcggctccggcgcccaagaagggctccaagaaggccatcacg aaggcccagaagaaagacggcaagaagcgcaagcgcggtcgcaaggagagctactccatc tacgtgtacaaggtgctcaagcaggtgcaccccgacacgggcatctcgtccaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgccagcgaggcgtcgcgc ctggcgcactacaacaagcgctccaccatcacgtcgcgcgaggtgcagacggccgtgcgc ctgctgctgcccggcgagctggccaagcacgccgtgtcggagggcaccaaagccgtcacc aagtacaccagctccaagtga

DBGET integrated database retrieval system