Ochotona princeps (American pika): 101532758 Help Entry 101532758         CDS       T07609                                  Symbol TXN Name (RefSeq) thioredoxin isoform X1   KO K03671   thioredoxin Organism opi  Ochotona princeps (American pika) Pathway opi04621   NOD-like receptor signaling pathway opi05012   Parkinson disease opi05132   Salmonella infection opi05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:opi00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     101532758 (TXN)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101532758 (TXN)   09164 Neurodegenerative disease    05012 Parkinson disease     101532758 (TXN)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     101532758 (TXN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:opi03110]     101532758 (TXN) Chaperones and folding catalysts [BR:opi03110]  Protein folding catalysts   Protein disulfide isomerase    101532758 (TXN) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 DIM1 OST3_OST6 Thioredoxin_2 Thioredoxin_9 AhpC-TSA Glutaredoxin Thioredoxin_7 Redoxin Motif Other DBs NCBI-GeneID:  101532758 NCBI-ProteinID:  XP_004580971 LinkDB All DBs Position 1A:19259587..19271156 Genome browser AA seq 105 aa AA seqDB search MVKQIESKSAFQEVLDSAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVLFIEVDVD DCQDIAADCEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELL NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcagatcgagagcaagtctgcttttcaggaagtgttggactctgcaggagat aagctagttgtggttgacttctcagccacgtggtgcggaccctgcaagatgatcaagcca ttctttcattccctctctgaaaaatattccaatgtgctgtttattgaagtagatgtggat gactgccaggatatcgctgcagactgtgaagtcaagtgcatgccaaccttccagtttttt aagaagggccagaaggtgggtgaattttctggagcaaataaggaaaaacttgaagccacc attaatgaactactctaa

DBGET integrated database retrieval system