Ochotona princeps (American pika): 101535232 Help Entry 101535232         CDS       T07609                                  Name (RefSeq) ubiquitin-like   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism opi  Ochotona princeps (American pika) Pathway opi03010   Ribosome opi04120   Ubiquitin mediated proteolysis opi04137   Mitophagy - animal opi04140   Autophagy - animal opi05012   Parkinson disease opi05022   Pathways of neurodegeneration - multiple diseases opi05167   Kaposi sarcoma-associated herpesvirus infection opi05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:opi00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     101535232   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     101535232  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101535232    04137 Mitophagy - animal     101535232  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     101535232    05167 Kaposi sarcoma-associated herpesvirus infection     101535232   09164 Neurodegenerative disease    05012 Parkinson disease     101535232    05022 Pathways of neurodegeneration - multiple diseases     101535232  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:opi03011]     101535232    04121 Ubiquitin system [BR:opi04121]     101535232   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:opi04147]     101535232 Ribosome [BR:opi03011]  Ribosomal proteins   Eukaryotes    Small subunit     101535232   Archaea     101535232 Ubiquitin system [BR:opi04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    101535232 Exosome [BR:opi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101535232   Exosomal proteins of colorectal cancer cells    101535232 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Ribosomal_S27 Rad60-SLD_2 Ubiquitin_2 DUF2604 TBK1_ULD Ubiquitin_5 Motif Other DBs NCBI-GeneID:  101535232 NCBI-ProteinID:  XP_036348826 LinkDB All DBs Position 6:605631..606062 Genome browser AA seq 143 aa AA seqDB search MQVFVKTLTGKTITLEVEPSDTIENVKAKVQDKEGIPLDQQRLIFAGKQLEYGRTLSDYN IQKESTLHLVLRLRGGAKKSKKQHKRKKVKLAVLKYHKVDENGQVSHLPRRCPSDECGAG VRGQPLRQALLQQVLSDLLLQQT NT seq 432 nt NT seq  +upstreamnt  +downstreamnt atgcaggtctttgtcaagacccttacaggcaagaccatcaccctcgaggttgagccctcg gatacgatagaaaacgtaaaagccaaagtccaggataaggaaggaattcctctggatcag caaagactgatctttgctggcaagcagctggaatatggccgaactttatcggactacaac attcagaaggagtctactctgcatctggtgctgagactccgtggtggtgccaagaaaagc aagaagcagcataagaggaaaaaggttaagctggctgtcctcaagtaccacaaggtggat gagaacggtcaagtcagccacctgcctcgcaggtgcccttctgatgagtgcggggctggc gttcgtggccagccgcttcgacaggcattgctgcagcaggtgctgtctgacctactgctt cagcaaacctga

DBGET integrated database retrieval system