Ochotona princeps (American pika): 101535373 Help Entry 101535373         CDS       T07609                                  Symbol S100A10 Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism opi  Ochotona princeps (American pika) Pathway opi04382   Cornified envelope formation opi05132   Salmonella infection Brite KEGG Orthology (KO) [BR:opi00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     101535373 (S100A10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101535373 (S100A10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:opi04147]     101535373 (S100A10) Exosome [BR:opi04147]  Exosomal proteins   Exosomal proteins of microglial cells    101535373 (S100A10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_6 EFhand_Ca_insen TMP_3 Motif Other DBs NCBI-GeneID:  101535373 NCBI-ProteinID:  XP_004588970 LinkDB All DBs Position 13:complement(111822762..111835477) Genome browser AA seq 97 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKGYLSKDDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD QCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccatctcaaatggaacatgccatggaaaccatgatgtttacctttcacaagtttgct ggggataaaggctacttgtcaaaggatgacctgagagtgctcatggagaaggagttccct gggtttttggaaaatcaaaaagaccctctggctgtggacaaaatcatgaaggacctggac cagtgccgagatggcaaagtggggttccagagcttcttctcgctgatcgcaggcctcacc attgcgtgcaacgactattttgtagtgcacatgaagcagaagggaaagaagtag

DBGET integrated database retrieval system