Ochotona princeps (American pika): 101536420 Help Entry 101536420         CDS       T07609                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism opi  Ochotona princeps (American pika) Pathway opi04024   cAMP signaling pathway opi04062   Chemokine signaling pathway opi04064   NF-kappa B signaling pathway opi04210   Apoptosis opi04380   Osteoclast differentiation opi04620   Toll-like receptor signaling pathway opi04621   NOD-like receptor signaling pathway opi04622   RIG-I-like receptor signaling pathway opi04623   Cytosolic DNA-sensing pathway opi04625   C-type lectin receptor signaling pathway opi04657   IL-17 signaling pathway opi04658   Th1 and Th2 cell differentiation opi04659   Th17 cell differentiation opi04660   T cell receptor signaling pathway opi04662   B cell receptor signaling pathway opi04668   TNF signaling pathway opi04722   Neurotrophin signaling pathway opi04920   Adipocytokine signaling pathway opi04926   Relaxin signaling pathway opi04931   Insulin resistance opi04936   Alcoholic liver disease opi05132   Salmonella infection opi05134   Legionellosis opi05135   Yersinia infection opi05140   Leishmaniasis opi05142   Chagas disease opi05145   Toxoplasmosis opi05160   Hepatitis C opi05161   Hepatitis B opi05162   Measles opi05163   Human cytomegalovirus infection opi05164   Influenza A opi05166   Human T-cell leukemia virus 1 infection opi05167   Kaposi sarcoma-associated herpesvirus infection opi05168   Herpes simplex virus 1 infection opi05169   Epstein-Barr virus infection opi05170   Human immunodeficiency virus 1 infection opi05171   Coronavirus disease - COVID-19 opi05200   Pathways in cancer opi05203   Viral carcinogenesis opi05208   Chemical carcinogenesis - reactive oxygen species opi05215   Prostate cancer opi05220   Chronic myeloid leukemia opi05222   Small cell lung cancer opi05235   PD-L1 expression and PD-1 checkpoint pathway in cancer opi05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:opi00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     101536420 (NFKBIA)    04668 TNF signaling pathway     101536420 (NFKBIA)    04024 cAMP signaling pathway     101536420 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     101536420 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101536420 (NFKBIA)    04621 NOD-like receptor signaling pathway     101536420 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     101536420 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     101536420 (NFKBIA)    04625 C-type lectin receptor signaling pathway     101536420 (NFKBIA)    04660 T cell receptor signaling pathway     101536420 (NFKBIA)    04658 Th1 and Th2 cell differentiation     101536420 (NFKBIA)    04659 Th17 cell differentiation     101536420 (NFKBIA)    04657 IL-17 signaling pathway     101536420 (NFKBIA)    04662 B cell receptor signaling pathway     101536420 (NFKBIA)    04062 Chemokine signaling pathway     101536420 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     101536420 (NFKBIA)    04926 Relaxin signaling pathway     101536420 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     101536420 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     101536420 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101536420 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     101536420 (NFKBIA)    05203 Viral carcinogenesis     101536420 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     101536420 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     101536420 (NFKBIA)    05215 Prostate cancer     101536420 (NFKBIA)    05222 Small cell lung cancer     101536420 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101536420 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     101536420 (NFKBIA)    05161 Hepatitis B     101536420 (NFKBIA)    05160 Hepatitis C     101536420 (NFKBIA)    05171 Coronavirus disease - COVID-19     101536420 (NFKBIA)    05164 Influenza A     101536420 (NFKBIA)    05162 Measles     101536420 (NFKBIA)    05168 Herpes simplex virus 1 infection     101536420 (NFKBIA)    05163 Human cytomegalovirus infection     101536420 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     101536420 (NFKBIA)    05169 Epstein-Barr virus infection     101536420 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     101536420 (NFKBIA)    05135 Yersinia infection     101536420 (NFKBIA)    05134 Legionellosis     101536420 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     101536420 (NFKBIA)    05140 Leishmaniasis     101536420 (NFKBIA)    05142 Chagas disease     101536420 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101536420 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     101536420 (NFKBIA)    04931 Insulin resistance     101536420 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:opi03000]     101536420 (NFKBIA)    04131 Membrane trafficking [BR:opi04131]     101536420 (NFKBIA) Transcription factors [BR:opi03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     101536420 (NFKBIA) Membrane trafficking [BR:opi04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     101536420 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 GnHR_trans SNN_linker Motif Other DBs NCBI-GeneID:  101536420 NCBI-ProteinID:  XP_004584817 LinkDB All DBs Position 17:33743645..33746624 Genome browser AA seq 313 aa AA seqDB search MFQPAEHAQDWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLQPQEAP RAAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLKQTCTAQHLHSILQATN YNGHTCLHLASIHGYLGIVELLVSWGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQRLPESEDEESYDTESEVTEDEL PYDDCVFGGQRLT NT seq 942 nt NT seq  +upstreamnt  +downstreamnt atgtttcagccggccgagcacgctcaggactgggccatggagggaccccgggatgggctc aagaaagagcgcctgctcgacgaccgccacgacagcggcctggattccatgaaggacgag gagtacgaacagatggtgaaggagctgcgcgagatccgcctgcagccgcaggaggcgccg cgcgccgccgagccttggaagcagcagctcaccgaggacggagactcgttcctgcacttg gccattatccacgaagagaaggcattgaccatggaagtgattcgccaggtgaagggagac ctggccttcctcaacttccagaacaacctgcagcagactccactgcacttggccgtgatc accaaccagccagaaattgctgaggcgctgctggaagctggctgcgatcctgagctgcgg gactttcgaggaaatactccactgcacctggcctgtgagcagggctgcctggccagcgtg ggggtcctcaagcagacctgcacagcccagcacttgcactccatcctgcaggccaccaac tacaacggccacacgtgtctgcacctagcttccatccacggctatctgggcatcgtggag ctgctggtgtcctggggcgctgacgtcaatgcccaggaaccctgcaacggccggacagcc ctgcacctggcggtggacctgcagaacccagacctggtgtcgcttttgctgaagtgcggg gctgacgtcaaccgggtgacctaccagggctactccccataccagctcacctggggccgg cccagcacccggatccagcagcagctgggccagctaaccttggaaaaccttcagagactg ccagagagtgaggacgaggagagctatgacaccgagtcggaggtcacagaggatgagctg ccctacgatgactgtgtgtttggaggccaacgtctgacatga

DBGET integrated database retrieval system