Ochotona princeps (American pika): 101536527 Help Entry 101536527         CDS       T07609                                  Name (RefSeq) cofilin-1-like   KO K05765   cofilin Organism opi  Ochotona princeps (American pika) Pathway opi04360   Axon guidance opi04666   Fc gamma R-mediated phagosome formation opi04810   Regulation of actin cytoskeleton opi05133   Pertussis opi05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:opi00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     101536527  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagosome formation     101536527   09158 Development and regeneration    04360 Axon guidance     101536527  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     101536527   09171 Infectious disease: bacterial    05133 Pertussis     101536527  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:opi04131]     101536527   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:opi04812]     101536527    04147 Exosome [BR:opi04147]     101536527 Membrane trafficking [BR:opi04131]  Others   Actin-binding proteins    Others     101536527 Cytoskeleton proteins [BR:opi04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      101536527 Exosome [BR:opi04147]  Exosomal proteins   Proteins found in most exosomes    101536527 SSDB OrthologParalogGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  101536527 NCBI-ProteinID:  XP_036353772 LinkDB All DBs Position X Genome browser AA seq 166 aa AA seqDB search MASGVAVWDGVIKVFNNMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV GQTVDDPYATFVKMLPDKDCHYALYDATYETKESKKEDLVFIFWAPECAPLKSKMIYASS KDAIKKKLTGIKHEFQANCYEEVKDRCTLAEKLGGSAVISLEGKPL NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atggcttctggagtggcggtgtgggatggtgtcatcaaggtgttcaacaacatgaaggtg cgcaagtcgtcgacgcccgaggaggtgaagaagcgcaagaaggcggtgctgttctgcctg agtgaggacaagaagaacatcatcctggaggagggcaaggagatcctggtgggcgatgtg ggccagaccgtggacgacccctacgccaccttcgtcaagatgctgcccgacaaggactgc cactacgccctgtatgacgccacctacgagaccaaggagagcaagaaggaggacctggtg ttcatcttctgggccccagagtgtgctcccctcaagagcaaaatgatctacgccagctcc aaggacgccatcaagaagaagctgacagggatcaagcacgagttccaagccaactgctac gaggaggtcaaggaccgctgcaccctggccgagaagctggggggcagtgcagtcatctct ctggagggcaagcccttgtga

DBGET integrated database retrieval system