Ochotona princeps (American pika): 105941968 Help Entry 105941968         CDS       T07609                                  Name (RefSeq) cytochrome c-like   KO K08738   cytochrome c Organism opi  Ochotona princeps (American pika) Pathway opi00190   Oxidative phosphorylation opi01100   Metabolic pathways opi01524   Platinum drug resistance opi04115   p53 signaling pathway opi04210   Apoptosis opi04215   Apoptosis - multiple species opi04932   Non-alcoholic fatty liver disease opi05010   Alzheimer disease opi05012   Parkinson disease opi05014   Amyotrophic lateral sclerosis opi05016   Huntington disease opi05017   Spinocerebellar ataxia opi05020   Prion disease opi05022   Pathways of neurodegeneration - multiple diseases opi05132   Salmonella infection opi05134   Legionellosis opi05145   Toxoplasmosis opi05152   Tuberculosis opi05160   Hepatitis C opi05161   Hepatitis B opi05162   Measles opi05163   Human cytomegalovirus infection opi05164   Influenza A opi05167   Kaposi sarcoma-associated herpesvirus infection opi05168   Herpes simplex virus 1 infection opi05169   Epstein-Barr virus infection opi05170   Human immunodeficiency virus 1 infection opi05200   Pathways in cancer opi05210   Colorectal cancer opi05222   Small cell lung cancer opi05416   Viral myocarditis opi05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:opi00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     105941968  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     105941968    04215 Apoptosis - multiple species     105941968    04115 p53 signaling pathway     105941968  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105941968   09162 Cancer: specific types    05210 Colorectal cancer     105941968    05222 Small cell lung cancer     105941968   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     105941968    05161 Hepatitis B     105941968    05160 Hepatitis C     105941968    05164 Influenza A     105941968    05162 Measles     105941968    05168 Herpes simplex virus 1 infection     105941968    05163 Human cytomegalovirus infection     105941968    05167 Kaposi sarcoma-associated herpesvirus infection     105941968    05169 Epstein-Barr virus infection     105941968   09171 Infectious disease: bacterial    05132 Salmonella infection     105941968    05134 Legionellosis     105941968    05152 Tuberculosis     105941968   09174 Infectious disease: parasitic    05145 Toxoplasmosis     105941968   09164 Neurodegenerative disease    05010 Alzheimer disease     105941968    05012 Parkinson disease     105941968    05014 Amyotrophic lateral sclerosis     105941968    05016 Huntington disease     105941968    05017 Spinocerebellar ataxia     105941968    05020 Prion disease     105941968    05022 Pathways of neurodegeneration - multiple diseases     105941968   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105941968    05416 Viral myocarditis     105941968   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     105941968   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     105941968 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG Motif Other DBs NCBI-GeneID:  105941968 NCBI-ProteinID:  XP_012783135 LinkDB All DBs Position X Genome browser AA seq 103 aa AA seqDB search MGDVEKGKKIFVQKCAQCHTVERRGKHKSGPNLHGLFGRKTGQAVSFSYTDVNKNTGITW EEDTMMEYLENPKKYIPGTKMIFASIKKNERADLIAYLKKSHQ NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgggtgatgttgagaaaggcaagaagatttttgttcagaagtgtgcccagtgtcacacc gtggaaagaagaggcaagcacaagtccggacccaatctccatggtctgtttgggcggaag accgggcaagcggtcagcttctcttacacagatgtcaacaagaacacgggcatcacctgg gaggaggacactatgatggaatacctggagaatcccaagaagtacatcccgggcaccaag atgatcttcgccagcattaagaagaatgagagggcagacctgatagcttatctcaaaaaa agccaccaatga

DBGET integrated database retrieval system