Ochotona princeps (American pika): 105942340 Help Entry 105942340         CDS       T07609                                  Name (RefSeq) profilin-1-like   KO K05759   profilin Organism opi  Ochotona princeps (American pika) Pathway opi04015   Rap1 signaling pathway opi04810   Regulation of actin cytoskeleton opi05014   Amyotrophic lateral sclerosis opi05132   Salmonella infection Brite KEGG Orthology (KO) [BR:opi00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     105942340  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     105942340  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105942340   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     105942340  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:opi04131]     105942340   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:opi04812]     105942340    04147 Exosome [BR:opi04147]     105942340 Membrane trafficking [BR:opi04131]  Others   Actin-binding proteins    Others     105942340 Cytoskeleton proteins [BR:opi04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      105942340 Exosome [BR:opi04147]  Exosomal proteins   Proteins found in most exosomes    105942340 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  105942340 NCBI-ProteinID:  XP_012785163 LinkDB All DBs Position 19:44379357..44381805 Genome browser AA seq 110 aa AA seqDB search ADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGQDRSSFFVNGLTLGGQKCS VIRDSLLQDGEFTMDLRTKSGSGAPTFNVTVTMTVPEELVCCFPQEGDVK NT seq 333 nt NT seq  +upstreamnt  +downstreamnt gcggatgggacctgtcaggacgcggccatcgtaggctacaaggactcgccctcggtctgg gccgccgtgccgggcaaaaccttcgtcaacatcacgccagctgaggttggtgtcctggtt ggccaagaccggtcaagcttctttgtgaatgggctgacacttgggggccagaagtgctcg gtgattcgggactcgctgctacaagatggggagttcaccatggatcttcgcaccaagagc ggcagcggggcgcccaccttcaatgtcactgtcaccatgactgtgcctgaagagttggtt tgttgctttccccaggagggggatgtgaaatga

DBGET integrated database retrieval system