Ochotona princeps (American pika): 118758269 Help Entry 118758269         CDS       T07609                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism opi  Ochotona princeps (American pika) Pathway opi04613   Neutrophil extracellular trap formation opi05034   Alcoholism opi05202   Transcriptional misregulation in cancer opi05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:opi00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     118758269  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     118758269   09163 Immune disease    05322 Systemic lupus erythematosus     118758269   09165 Substance dependence    05034 Alcoholism     118758269  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:opi03036]     118758269   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:opi04147]     118758269 Chromosome and associated proteins [BR:opi03036]  Eukaryotic type   Nucleosome assembly factors    Histones     118758269 Exosome [BR:opi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118758269 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF GHL13 Motif Other DBs NCBI-GeneID:  118758269 NCBI-ProteinID:  XP_036349813 LinkDB All DBs Position 12:93127575..93127928 Genome browser AA seq 117 aa AA seqDB search MAPTKQTARKSAGGIAPRKQLATKAVLKSSPSTGGVKKSTELLIRILPFQRLVRKIVQDF KTDLHFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKHVTIMPKHIQLARRIHGECA NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggctcctacaaagcagactgcccgcaaatcagctggtggcatagcacccagaaaacaa ctggctacaaaagccgttctcaagagttcgccctctactggaggggtaaagaagtccact gagcttctgattcgcatactccccttccaacgtctggtgcgaaaaattgttcaggatttc aaaacagatctgcacttccagagtgcagctattggtgctttgcaggaggcaagtgaggcc tatctggttggcctttttgaagacaccaacctgtgtgctatccatgccaaacatgtaaca attatgccaaaacacatccagctagcacgccgcatacatggagaatgtgcttaa

DBGET integrated database retrieval system