Odobenus rosmarus divergens (Pacific walrus): 101382125
Help
Entry
101382125 CDS
T05148
Symbol
IFNG
Name
(RefSeq) interferon gamma
KO
K04687
interferon gamma
Organism
oro
Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro03050
Proteasome
oro04060
Cytokine-cytokine receptor interaction
oro04066
HIF-1 signaling pathway
oro04217
Necroptosis
oro04350
TGF-beta signaling pathway
oro04380
Osteoclast differentiation
oro04612
Antigen processing and presentation
oro04630
JAK-STAT signaling pathway
oro04650
Natural killer cell mediated cytotoxicity
oro04657
IL-17 signaling pathway
oro04658
Th1 and Th2 cell differentiation
oro04659
Th17 cell differentiation
oro04660
T cell receptor signaling pathway
oro04940
Type I diabetes mellitus
oro05140
Leishmaniasis
oro05142
Chagas disease
oro05143
African trypanosomiasis
oro05144
Malaria
oro05145
Toxoplasmosis
oro05146
Amoebiasis
oro05152
Tuberculosis
oro05160
Hepatitis C
oro05164
Influenza A
oro05168
Herpes simplex virus 1 infection
oro05200
Pathways in cancer
oro05235
PD-L1 expression and PD-1 checkpoint pathway in cancer
oro05321
Inflammatory bowel disease
oro05322
Systemic lupus erythematosus
oro05323
Rheumatoid arthritis
oro05330
Allograft rejection
oro05332
Graft-versus-host disease
oro05418
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:
oro00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03050 Proteasome
101382125 (IFNG)
09130 Environmental Information Processing
09132 Signal transduction
04350 TGF-beta signaling pathway
101382125 (IFNG)
04630 JAK-STAT signaling pathway
101382125 (IFNG)
04066 HIF-1 signaling pathway
101382125 (IFNG)
09133 Signaling molecules and interaction
04060 Cytokine-cytokine receptor interaction
101382125 (IFNG)
09140 Cellular Processes
09143 Cell growth and death
04217 Necroptosis
101382125 (IFNG)
09150 Organismal Systems
09151 Immune system
04650 Natural killer cell mediated cytotoxicity
101382125 (IFNG)
04612 Antigen processing and presentation
101382125 (IFNG)
04660 T cell receptor signaling pathway
101382125 (IFNG)
04658 Th1 and Th2 cell differentiation
101382125 (IFNG)
04659 Th17 cell differentiation
101382125 (IFNG)
04657 IL-17 signaling pathway
101382125 (IFNG)
09158 Development and regeneration
04380 Osteoclast differentiation
101382125 (IFNG)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
101382125 (IFNG)
05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
101382125 (IFNG)
09172 Infectious disease: viral
05160 Hepatitis C
101382125 (IFNG)
05164 Influenza A
101382125 (IFNG)
05168 Herpes simplex virus 1 infection
101382125 (IFNG)
09171 Infectious disease: bacterial
05152 Tuberculosis
101382125 (IFNG)
09174 Infectious disease: parasitic
05146 Amoebiasis
101382125 (IFNG)
05144 Malaria
101382125 (IFNG)
05145 Toxoplasmosis
101382125 (IFNG)
05140 Leishmaniasis
101382125 (IFNG)
05142 Chagas disease
101382125 (IFNG)
05143 African trypanosomiasis
101382125 (IFNG)
09163 Immune disease
05322 Systemic lupus erythematosus
101382125 (IFNG)
05323 Rheumatoid arthritis
101382125 (IFNG)
05321 Inflammatory bowel disease
101382125 (IFNG)
05330 Allograft rejection
101382125 (IFNG)
05332 Graft-versus-host disease
101382125 (IFNG)
09166 Cardiovascular disease
05418 Fluid shear stress and atherosclerosis
101382125 (IFNG)
09167 Endocrine and metabolic disease
04940 Type I diabetes mellitus
101382125 (IFNG)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03051 Proteasome [BR:
oro03051
]
101382125 (IFNG)
09183 Protein families: signaling and cellular processes
04052 Cytokines and neuropeptides [BR:
oro04052
]
101382125 (IFNG)
00536 Glycosaminoglycan binding proteins [BR:
oro00536
]
101382125 (IFNG)
Proteasome [BR:
oro03051
]
Eukaryotic proteasome
Assembling factors
Other assembling factors
101382125 (IFNG)
Cytokines and neuropeptides [BR:
oro04052
]
Cytokines
Interferons
101382125 (IFNG)
Glycosaminoglycan binding proteins [BR:
oro00536
]
Heparan sulfate / Heparin
Cytokines
101382125 (IFNG)
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
IFN-gamma
DUF7774
Motif
Other DBs
NCBI-GeneID:
101382125
NCBI-ProteinID:
XP_004416484
UniProt:
A0A2U3X2V9
LinkDB
All DBs
Position
Unknown
AA seq
166 aa
AA seq
DB search
MNYTGYILAFQLCVILCSSGYYCQAMFFKEIENLKEYFNASNPDVADGGPLFLDILKNWR
EESDKTIIQSQIVSFYLKLFENFRDNQIIQRSMDTIKEDMLVKFFNSSNSKRDDFLKLIR
IPVNDLQVQRKAINELIKVMSDLSPRSNLRKRKRSQNLFRGRRASK
NT seq
501 nt
NT seq
+upstream
nt +downstream
nt
atgaattacacaggctatatcttagcttttcagctttgcgtgattttgtgttcttctggt
tactactgtcaggccatgttttttaaagaaatagagaacctaaaggaatattttaatgca
agtaatccagatgtagcagacggtgggcctcttttcttagacattttgaagaactggaga
gaggagagtgacaaaacaatcattcaaagccaaatcgtctccttctacttgaaactgttt
gaaaactttagagataatcagatcattcaaaggagcatggataccatcaaggaagacatg
cttgtcaagttcttcaatagcagcaacagtaagagggatgacttcctcaagctgattcga
attcccgtgaatgatctgcaggtccagcgcaaagcgataaatgaactcatcaaagtgatg
agtgatctctcaccaagatctaacctaaggaagcggaaaaggagtcagaatctgtttcga
ggccgcagagcatcgaaataa
DBGET
integrated database retrieval system