KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107275437
Entry
107275437         CDS       T01015                                 
Name
(RefSeq) CTP synthase 1-like
  KO
K01937  CTP synthase [EC:6.3.4.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
osa01240  Biosynthesis of cofactors
Module
osa_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    107275437
Enzymes [BR:osa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.2  CTP synthase (glutamine hydrolysing)
     107275437
SSDB
Motif
Pfam: CTP_synth_N GATase Peptidase_C26 CbiA
Other DBs
NCBI-GeneID: 107275437
NCBI-ProteinID: XP_015638695
UniProt: A0A0P0WQH1
LinkDB
Position
5:28392045..28398016
AA seq 607 aa
MKYVVVMGGVISGLGKGVTASSIGVVLKACGLRVTSIKIDPYFNADAGTISPHEHGEVFV
LDDGGEADLDLGNYERFLDIKLTRDHSITAGKIHHYVYEKERRGDYLGQTVQVIPHITNE
IQDWIERVAIVPVDGEVDPADVCIIELGGTIGDIESTQFIEAFSQFSYRVGAGNLCVVHV
GLVPVLNVVGEQKTKPTQNSIRKLREYGLTPNIIACRCTKELERSVKEKLSLFCHVPVAN
IFTLCDVSNIWRVPLLLRDQKAHEAILKVLNLESVAGEPNLEEWTARADLYDTLQETVRI
AMVGKYTGVSDTYLSVMKALLHACIACGRKLVVDWVPSTDLEDSTATVAPDAYNTAWSLL
RGADGILVPGGFGERGVEGKILAVKYARENDVPFLGICLGMQLTAVEFARHVLKLPDANS
TEFDAKTENPCVTIMPECSNEGKGGTMRRGSKRIFFKVAGSKSAKLYGSVSHIDERFRHR
YQVNPNMVQLFENSGLQVVGTDKTGERVQIVEIPNHRFFVGVQFHPEFKSRPSKPSALFV
GLIAASCGQLDDALQDAACNHEPQQNRRGEKRLAASDLGDGTCRSKRQVKACSNSNDTDE
AQDVTTC
NT seq 1824 nt   +upstreamnt  +downstreamnt
atgaagtacgtggtggtgatgggaggcgtgatcagcggcctcggcaagggggtgacggcg
agcagcattggcgtcgtcctcaaggcgtgcggcctccgcgttacgtccattaagatcgat
ccttactttaacgctgatgccggaactatatctcctcatgaacacggcgaagtgtttgtg
ttagatgatggtggtgaggcggacttggatcttgggaactatgagaggtttctcgacatt
aaactaactcgagaccatagcataaccgccgggaagatccatcattatgtttatgagaaa
gagagaaggggggactacttgggtcagactgttcaggttatcccacatattacaaatgag
atacaagattggattgagcgtgtcgcgatagttccggttgatggcgaggtggatcctgcc
gatgtctgtataatagagctcggtggcactataggcgatattgaatccacacaatttatt
gaagcctttagtcaattctcctatcgtgttggtgctggtaatttatgtgtggtgcacgtc
ggtcttgttccagttctgaacgttgtgggtgagcagaaaactaagcccactcaaaatagt
atacgtaagttaagagaatatggtctcacgccaaatattatagcttgccgttgtactaag
gaactggagagaagtgtgaaagaaaaactctctctcttctgccatgtgccggtagctaac
atttttactctgtgtgacgtttcaaacatctggcgtgttcctctgttattgcgggaccaa
aaggcacatgaagctattcttaaagttttgaatcttgaaagtgttgctggtgagcctaac
ttggaggaatggacggcaagggctgatctatatgacacactacaagaaacagtcagaatt
gccatggttggaaaatacaccggtgtatctgatacatacctttcagtgatgaaggctctt
ctacatgcttgtatagcttgtggcagaaaacttgttgttgattgggttccttccaccgat
cttgaggattcaactgccactgtggcacctgatgcttacaacacagcatggagtttactg
aggggtgcagatggcattttagtacctggtggctttggagagagaggtgttgaggggaaa
atattggctgttaagtatgcccgcgaaaacgatgtccctttcctgggcatatgccttggc
atgcagctcactgcggttgaatttgcacgccatgttttgaaattgcctgatgctaacagc
acagaatttgatgccaaaacggagaatccatgtgtgaccataatgccagagtgctccaac
gaaggaaagggtggtaccatgcgacgtggatcaaagaggatatttttcaaggttgcaggt
agcaagtctgccaagctatatggtagcgtcagccacatagatgagaggtttcggcacaga
taccaggtaaatcccaatatggtgcaattatttgagaacagtgggcttcaggttgtaggc
acagacaagaccggagaaagggtgcagatcgtcgaaatacccaatcatcgatttttcgtt
ggtgttcaatttcaccccgagtttaagtcgagaccttcgaaaccttctgcactttttgtc
ggactaatcgctgcatcgtgtgggcaactggatgatgcgttgcaagatgcggcttgtaac
catgagccacaacagaatcggcgtggagagaagcgtcttgctgctagtgatcttggagac
ggaacctgccgcagcaaacggcaagtgaaggcgtgctctaattcgaatgacactgatgaa
gcacaggatgttacaacctgttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324172
Entry
4324172           CDS       T01015                                 
Name
(RefSeq) CTP synthase
  KO
K01937  CTP synthase [EC:6.3.4.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
osa01240  Biosynthesis of cofactors
Module
osa_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    4324172
Enzymes [BR:osa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.2  CTP synthase (glutamine hydrolysing)
     4324172
SSDB
Motif
Pfam: CTP_synth_N GATase Peptidase_C26 CbiA
Other DBs
NCBI-GeneID: 4324172
NCBI-ProteinID: XP_015622258
UniProt: Q5VPD3 B9EYD7
LinkDB
Position
1:26514526..26521700
AA seq 602 aa
MKYVLVTGGVVSGLGKGVTASSIGVVLKACGLRVTTIKIDPYLNTDAGTMSPFEHGEVFV
LDDGGEVDLDLGNYERFLDIKLTRDNNITTGKIYQSVINKERRGDYLGKTIQVVPHITDE
IQDWIERVAMNPVDGKEGPPDVCVIELGGTIGDIESMPFIEALGQFSYRVGPGNFCLVHV
SLVPVLNVVGEQKTKPTQHSVRGLRGLGLAPDILACRSTEPLEENVKAKLSQFCHVPVSS
IINLHDVTNIWHIPLLLRDQRAHEAILKVLDLQFVGKVPREPKLVEWTERASKFDKLKAT
VKIAMVGKYTGLSDSYLSVLKALLHASVAMGRKLVVEWVPSCDLEDSAAKETPEAHKKAW
KLLKGAEGILVPGGFGDRGVQGKILAAKYARENNVPYLGICLGMQIAVIDFACSIMKLPG
ANSTEFDPDTMSPCVIFMPEGSKTHMGATMRLGSRRTYFHATACKSAKLYGNARFVDERH
RHRYEVNPEMVPEFEKAGLSFVGKDESGRRMEIIELPSHKFFIGVQFHPEFKSRPGKPSP
LFLGLIAAASGQLETLLQPSSNIVNPNPMPRFPIPKKTIYHAKKPLDSLVNGYFANGNVI
HT
NT seq 1809 nt   +upstreamnt  +downstreamnt
atgaagtacgtgctggtgacaggaggggtggtgagcggcctcggcaagggcgtgaccgcg
agcagcatcggcgtcgtgctcaaggcctgcgggctccgcgtcaccaccatcaagattgac
ccatacctcaacactgatgctggaaccatgtctccgttcgagcatggtgaggtcttcgtt
ttggacgatggtggagaggtggacttggaccttggaaattacgaacgttttctggacatc
aaattgacccgtgataacaacataaccacgggaaaaatatatcagtcagtcattaacaaa
gaaaggagaggagactacttggggaaaaccattcaggttgtgccacatattacagatgaa
attcaagattggattgaacgtgtagcgatgaatccggtcgatggtaaagaaggacctcct
gatgtttgtgtcatagaacttggtggcaccataggggatattgaatcaatgccctttatt
gaagcattaggtcaattttcctaccgtgttggacctggaaacttctgtctggtccatgtc
agtcttgttccagttttaaatgtagttggtgaacagaaaactaaacctacccagcatagt
gttcgtgggctaagaggccttggattggcacctgacattttagcatgtcgcagtaccgag
ccactggaagaaaacgtgaaagcaaagctctcacaattttgtcacgttccagtctcaagt
attattaatctccatgacgttacaaacatttggcacatccccttgttgctaagggaccaa
agggcccatgaagctattctgaaagttctagaccttcaatttgtcggtaaagtaccacga
gaacccaagttggttgaatggaccgaaagagccagcaagtttgacaagttgaaggctacg
gttaagattgcgatggttggaaaatatactgggctgtccgattcctacctgtctgttcta
aaggcacttttgcatgcatcggttgctatgggaagaaagcttgtagtggagtgggttcct
tcctgtgatcttgaagattctgcagccaaagagacccctgaagcccataaaaaagcatgg
aagctactcaagggtgcagagggtatacttgtccctggaggctttggagatagaggtgtt
cagggaaaaattcttgctgcaaaatatgcacgagaaaataatgttccttatctcggcatt
tgcttgggtatgcaaattgcagtgattgattttgcctgttctatcatgaaattaccgggt
gcaaatagcacagagtttgacccagatacaatgtcaccctgcgtcattttcatgccagag
ggttccaaaacccatatgggggcaactatgcggcttggatcaaggagaacatatttccat
gccactgcatgcaaatctgcaaagctgtatggtaatgctagattcgtagacgaaagacat
cgacacagatatgaggtaaatcctgaaatggtaccagagtttgagaaggccggactttca
tttgttggcaaggatgagagtggaagacgcatggagattattgaactacccagtcataaa
tttttcattggagtacagttccatcctgaattcaagtcaagaccagggaagccatctcca
cttttcttaggattaatagcagcagcatctggacaactagaaactttgctccaaccaagt
tccaacattgtcaatccaaatcctatgcccagatttcccattcccaaaaagacgatttac
catgccaagaagccactggacagcttggtaaacggatactttgcaaatggcaacgtcatc
cacacttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326656
Entry
4326656           CDS       T01015                                 
Name
(RefSeq) CTP synthase isoform X1
  KO
K01937  CTP synthase [EC:6.3.4.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
osa01240  Biosynthesis of cofactors
Module
osa_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    4326656
Enzymes [BR:osa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.2  CTP synthase (glutamine hydrolysing)
     4326656
SSDB
Motif
Pfam: CTP_synth_N GATase Peptidase_C26 CbiA
Other DBs
NCBI-GeneID: 4326656
NCBI-ProteinID: XP_015621404
LinkDB
Position
1:complement(24499182..24504876)
AA seq 605 aa
MKYVLVTGGVVSGLGKGVTASSIGVVLKSCGLRITSIKIDPYLNTDAGTMSPFEHGEVFV
LDDGGEVDLDLGNYERFLDIKLTRDNNITTGKIYQSVLEKERKGEYLGKTVQVVPHITNA
IQEWIERVAMVPVDGKEGPADVCVIELGGTIGDIESMPFIEALGQFSYRVGPGNFCLVHV
SLVPVLNVVGEQKTKPTQHSVRGLRGLGLTPNILACRSTKELEENVKEKLSQFCHVPAAN
IVTLYDVSNIWRIPLLLRDQKAHEAILKVLNLDSFARGPKLDEWVARATLFDALQDTVRI
AMVGKYTGLSDSYLSVLKALLHASVDCRRKLLVDWVASTDLEDSTAIEAPDAYKAAWDLL
KGANGVLVPGGFGDRGIQGKILAAKYARENNVPYLGICLGMQLAVVEFARSVMNLPEANS
TEFDPNAKTPCVIFMPEGSKTHMGGTMRLGSRRTFFEVADCKSAKLYGNVSYVDERHRHR
YEVNPDMVPEFENAGLQFVGKDETGRRMEIIEIPNHRYFVGAQFHPEFKSRPSKPSPLFV
GLIAASSGQLDRLLQGSCNGHVVSTKHSLSNGAYTSTVHQNGHAKKLANGLSNGTYYPNG
NGVHA
NT seq 1818 nt   +upstreamnt  +downstreamnt
atgaagtacgtgctggtgaccggcggggtggtgagcgggctcgggaagggcgtcacggcg
agcagcatcggcgtcgtcctcaagtcgtgcgggctccgcattacctccatcaagatcgat
ccttaccttaacacagatgctgggaccatgtccccgttcgaacatggtgaggtttttgtg
cttgatgatggtggcgaggtggacttggatcttgggaattacgagaggtttcttgacatt
aaactaaccagggacaataatataaccacaggaaagatctaccagtccgttcttgaaaag
gaaaggaagggggaatacttgggaaagactgttcaggttgtcccgcatatcacaaatgcc
atacaagagtggattgagcgtgtcgcaatggtacctgtagatggcaaggagggaccagct
gatgtttgtgtgatagaacttgggggtactataggggatattgaatctatgccatttatc
gaagctttgggccaattctcatatcgtgttggtcctggtaacttttgtttggtgcatgtt
agtcttgttccagttctgaatgttgttggtgaacagaaaactaagccgactcaacatagt
gtccgtggattaaggggtcttgggctcacaccaaatattttagcctgtcgcagtactaag
gaactggaagaaaatgtgaaggagaaactctctcagttctgccatgtaccggcagctaac
attgtcactctgtatgatgtttccaacatttggcgtattcctttgttgctacgggaccaa
aaggcacatgaagccattcttaaagtgctgaaccttgatagctttgctcgggggccaaag
ttggatgaatgggtcgcaagagctacgttatttgatgcacttcaggatactgtgaggatt
gctatggttgggaagtatactggtctatctgattcatacctctctgtgttgaaggcactc
ttgcatgcttctgttgattgccgcaggaagcttcttgttgattgggttgcttctactgat
ctcgaagactccactgccattgaggcgcctgatgcttataaagcagcatgggatttactg
aagggtgccaatggtgttttagtacctggtggctttggagatagaggtattcaagggaag
attttggctgccaagtatgcccgtgaaaacaatgtaccatatcttggcatatgccttgga
atgcaacttgctgtggttgaatttgctcgaagtgtcatgaatctccctgaagcaaacagc
acagaatttgatcccaatgccaagaccccatgtgttatttttatgcctgagggttctaaa
acacatatgggtggcacgatgcgcctaggatcaaggaggacatttttcgaggttgctgat
tgcaagtctgctaaattgtatggcaatgtcagttatgtagatgagaggcatcggcacaga
tatgaggtgaatccagatatggtgccagagtttgaaaatgctggacttcagtttgttggg
aaagatgagactggaaggagaatggagataattgaaatccccaatcaccgatattttgtt
ggtgcacaattccatcctgaattcaagtcaagaccttcaaaaccgtctccactctttgtc
ggactaattgctgcctcatctgggcaactggatagattgctgcaaggcagctgcaatggc
cacgtggtttctactaaacattctctgagcaatggtgcttacacatctacagtacaccaa
aatgggcacgcaaagaagcttgccaatggtctttccaatggaacatattatcccaatgga
aatggcgtgcatgcctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339675
Entry
4339675           CDS       T01015                                 
Name
(RefSeq) CTP synthase
  KO
K01937  CTP synthase [EC:6.3.4.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
osa01240  Biosynthesis of cofactors
Module
osa_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    4339675
Enzymes [BR:osa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.2  CTP synthase (glutamine hydrolysing)
     4339675
SSDB
Motif
Pfam: CTP_synth_N GATase Peptidase_C26 CbiA NodZ
Other DBs
NCBI-GeneID: 4339675
NCBI-ProteinID: XP_015640219
UniProt: B9FLQ5 Q65XK2
LinkDB
Position
5:complement(28551310..28557317)
AA seq 608 aa
MKYVLVTGGVVSGLGKGVTASSIGVVLKDCGLRVTSIKIDPYLNTDAGTMSPFEHGEVFV
LDDGGEVDLDLGNYERFLDIKLTRDNNITTGKIYQAVIDKERRGDYLGKTVQVVPHITDE
IQEWIERVAMNPVDGTDEPADVCVIELGGTIGDIESMPFIEALGQFSYRVGAGNFCLVHV
SLVPVLNVVGEQKTKPTQHSVRGLRGLGLIPDILACRSTQPLEENVKVKLAQFCHVPISN
IVNLHDVTNIWHIPLLLRDQKAHESILKVLDLQCVGKVPRAPKLTEWTERASKFDKLKTP
VRIAMVGKYTGLSDSYLSVLKALLHASVALDRKLVVDWVPSCDLEDSAATETPDAYEKAW
DLLKGAHGVLVPGGFGDRGVQGKILAAKYARENNVPYLGICLGMQIAVIEFARSVMKLRG
ANSTEFDPATTTPCVIFMPEGSKTHMGATMRLGSRRTFFQANTCKSAKLYGNASYVDERH
RHRYEVNPEMVPEFEKAGLSFVGRDESGTRMEIIELPTHRFFVGAQFHPEFKSRPGKPSP
LFMGLIAASSGQLDHLLQQSCGVVSSPVRRGNYCNGATKQQKLYQNGHVKNGLVNGCYYA
NGNSILHT
NT seq 1827 nt   +upstreamnt  +downstreamnt
atgaagtacgtgctggtgacgggcggggtggtgagcggcctcgggaagggggtgacggcg
agcagcatcggcgtcgtgctcaaggactgcggcctccgcgtcacctccatcaagatcgat
ccttacctcaacaccgatgctggaaccatgtctccattcgagcacggtgaagtgtttgtt
ttggacgatggtggtgaggtggacttggaccttggaaattatgagcgatttctggacatc
aagttgactcgtgacaacaatataaccacgggaaagatctatcaggctgttattgacaag
gaacgaagaggagactacttgggaaaaactgttcaggttgtaccacacattacggatgaa
atacaggagtggattgaacgtgtggcaatgaatccagttgatggcacagatgagccagct
gatgtttgtgtaatagaacttggtggcactataggggatattgaatcaatgccttttatt
gaagcattaggtcaattttcataccgcgtaggggctggaaacttttgcctagttcatgtc
agtcttgtaccagttctaaatgtagttggtgaacagaaaaccaaacctacccaacatagt
gtccgtggactaagaggacttggactgatacctgatattttagcatgtcgcagtactcag
ccacttgaagaaaatgtgaaagtgaaactcgcacaattttgccacgttccgatctcaaat
attgtcaatcttcacgatgttaccaacatctggcacatccctttgttgcttagggaccag
aaggctcatgaatctattctgaaagttttagatcttcaatgtgtgggaaaagtgcctcga
gcacctaagctgactgaatggactgaaagagccagcaaattcgacaaactgaaaactcct
gttaggattgccatggttggaaagtatactggcctatcagactcctacttgtcagttttg
aaggctcttctgcatgcatcggttgctttggacagaaaacttgtggtggattgggttcct
tcctgtgatcttgaagattctgcagccacagagactcctgatgcatatgaaaaagcttgg
gatctactaaagggtgcacatggtgtactagttccaggaggctttggagatagaggggtc
cagggaaaaattcttgctgcaaaatatgcgcgagaaaacaatgttccatatcttggtatt
tgcctgggcatgcaaattgcagtgatcgaattcgcccgctctgtcatgaagttgcgtggt
gctaatagtacagagtttgatccagctacaacgacgccatgtgttattttcatgccggag
ggctctaaaacccatatgggggcaacaatgcgccttggatcaaggaggaccttcttccag
gccaatacatgcaaatcagctaagctgtatggcaatgcaagctatgtagatgaaaggcac
cgccaccgatatgaggtgaatcctgaaatggttccagaatttgagaaggcaggtctctct
tttgttggcagggatgaaagcgggacacgcatggagataattgagctaccaactcatagg
ttttttgttggcgcacaatttcatcctgaattcaagtcaagacctggaaagccatcccca
cttttcatgggattaatagcagcttcatcaggacagcttgaccatttacttcagcaatct
tgcggcgttgtcagctcgccagtcagacgtggcaactactgcaacggagccacgaaacaa
cagaagctataccaaaatggacatgtcaagaacggcctggtgaacggctgctactatgca
aacggcaacagcattcttcatacttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352499
Entry
4352499           CDS       T01015                                 
Name
(RefSeq) CTP synthase isoform X1
  KO
K01937  CTP synthase [EC:6.3.4.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
osa01240  Biosynthesis of cofactors
Module
osa_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    4352499
Enzymes [BR:osa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.2  CTP synthase (glutamine hydrolysing)
     4352499
SSDB
Motif
Pfam: CTP_synth_N GATase Peptidase_C26 CbiA MeaB
Other DBs
NCBI-GeneID: 4352499
NCBI-ProteinID: XP_015618284
UniProt: Q2QNR7 A0A8J8Y0I0
LinkDB
Position
12:complement(22656384..22662606)
AA seq 581 aa
MAEPGEDAAAAAAAASTKYVLITGGVVSGLGKGVTASSVGVVLKACGLRVTCIKIDPYLN
TDAGTMSPFEHGEVFVLDDGGEVDLDLGNYERFLDVTLTRDNNITTGKIYQSVIEKERKG
DYLGKTVQVVPHVTDEIKQWIQSVSSVPVDGQTRPADVCVIELGGTVGDIESMPFIEALR
QLSFSLGKDNFCLIHVSLVPVLGVVGEQKTKPTQHSVRELRALGLTPDLLACRSAQPLIG
SVKEKLSQFCHVPVENILNIHDVPNLWHVPLILRNQKVHEAIIKQLNLGRSAGPPELRDW
TQMAESYDDLKNSVKIALVGKYTNLTDSYLSVVKALLHASVACSLKPSIQWIAASDLEDA
TATSAPDAHAKAWETLKGSSCILIPGGFGDRGISGMILAAKYARENKVPYLGICLGMQIS
VIEMSRNVLGLKDADSEEFNSETPFRVVMYMPEVSKTHMGNTMRLGCRRTFFRRTDCLTS
KLYGSPEHVDERHRHRYEVNPSFVAMLENAGLHFVGCDESGKRMEVVELQDHPFYIGVQF
HPEFKSRPRRPSPPFTGLILAAAEYMGTPANNSNGHVGTSE
NT seq 1746 nt   +upstreamnt  +downstreamnt
atggcggagcccggggaggatgcggcagcggcagcggcggcggcgtcgaccaagtacgtg
ctcatcaccggcggcgtcgtcagcgggctcgggaagggggtcacggccagcagcgtcggc
gtcgtcctcaaggcctgcggcctccgcgtcacctgcatcaagatcgatccatatttaaac
acagatgctggtacaatgtctccttttgagcatggtgaggtctttgtgcttgacgatggt
ggagaggttgacttggatttagggaattatgagcgtttcttggatgttactctgacaagg
gataacaacattacaactggaaagatatatcagtctgtcattgagaaggagaggaagggt
gactatcttggaaagacggtccaggttgttcctcatgtaactgatgaaattaaacagtgg
atacagtcagtatcttctgttcctgtggatgggcagactcgtccagctgatgtttgtgtc
attgaattgggaggcactgtaggtgatattgaatcaatgccattcattgaagctctgcgc
cagttgtcattttctcttggtaaggacaatttctgcctcatacatgtgagccttgttccg
gtattgggtgtagttggtgagcagaaaactaagccaacacaacacagtgtacgagaacta
agggccttgggtctgactcctgatcttctagcatgccgatccgcacagccactaatagga
tctgtcaaggagaaactttcacaattttgtcatgtaccggttgagaatatacttaacatc
catgatgttccaaacttgtggcatgttccacttattcttagaaaccaaaaggttcacgag
gctataatcaaacaacttaaccttggaaggtctgctggaccccctgagttacgagattgg
acacagatggctgagtcatatgatgacctcaaaaactctgttaaaatcgctttggttggg
aaatatactaatctgaccgattcctacttatcagtggtgaaggctcttctacatgcgagt
gttgcatgttcattgaaaccttctatccagtggattgcagcttcagatcttgaagatgca
actgcaacaagtgcaccagatgcccatgctaaagcttgggaaactcttaagggttcctct
tgcattttgataccaggaggattcggggatcgtggaatatctgggatgatattggctgca
aaatatgctcgtgagaataaagttccataccttggcatttgcttgggaatgcagatatca
gtgattgagatgtccagaaatgttcttggcctaaaggatgcagacagtgaagagttcaac
tcagaaacaccatttcgtgtggttatgtacatgcctgaggtttcaaaaacgcacatggga
aatacaatgaggttgggttgccgaagaacgttctttcgcaggacagattgtcttacatca
aaactatatgggagccctgagcatgtagatgagcgtcatcgtcacagatatgaggtgaac
ccttctttcgttgctatgcttgaaaacgctggccttcattttgttggttgcgatgaaagt
ggaaagaggatggaggttgtagagctacaagaccacccattttacataggtgttcaattc
catccagaatttaagtcaaggcctcggagaccttcacctccatttactggtctaatattg
gcagcagctgaatacatgggaacacctgcaaataactcaaatggacatgttggaacatct
gagtaa

DBGET integrated database retrieval system