KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107275844
Entry
107275844         CDS       T01015                                 
Name
(RefSeq) heat shock cognate 70 kDa protein-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
osa04141  Protein processing in endoplasmic reticulum
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107275844
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107275844
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107275844
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    107275844
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    107275844
   03009 Ribosome biogenesis [BR:osa03009]
    107275844
   03110 Chaperones and folding catalysts [BR:osa03110]
    107275844
   04131 Membrane trafficking [BR:osa04131]
    107275844
   03051 Proteasome [BR:osa03051]
    107275844
   03029 Mitochondrial biogenesis [BR:osa03029]
    107275844
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    107275844
Protein phosphatases and associated proteins [BR:osa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     107275844
Spliceosome [BR:osa03041]
 Complex B
  Other components
   Prp19 complex
    107275844
 Complex C
   Prp19-CDC5 complex
    107275844
Ribosome biogenesis [BR:osa03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    107275844
Chaperones and folding catalysts [BR:osa03110]
 Heat shock proteins
  HSP70 / DNAK
   107275844
Membrane trafficking [BR:osa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    107275844
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    107275844
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    107275844
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    107275844
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   107275844
SSDB
Motif
Pfam: HSP70 MreB_Mbl Hydantoinase_A
Other DBs
NCBI-GeneID: 107275844
NCBI-ProteinID: XP_015644285
UniProt: A0A0P0V6T7
LinkDB
Position
1:complement(28425418..28427635)
AA seq 503 aa
MMAETGDQHGPVIGIDLGTACSCVAVWQNGRAEIVTNEHGGRATPSYAAFTDTERLVGDA
AKSQASRNPTNTVFATKRLMGRRFSDASVQDGLKLWPFKVVPGRGDKPMVAASYKGKQKL
LAAEEVASMLLSKMKAEAEAYIGGPVKNAVVTVPASFDVLQRRATKHACAVAGLDVLGVI
HGPAAAAVAFGIHEIAGDKNVLVFDLGGGHTSVSLLAVASGKIAVRATAGDPHLGGEDFN
GRMVEHFVAQFKAEHKKDVGRNARAILRLRAACEQAKRTLSSASWAAIELERLHDGADFY
STITRDQFDELNLDLFCKCLDPIKKCLTGAKMDRSSVDDVVFVGGSTRIPRVRRLIQDLF
DGKELRKDISSDEAAACGAATMASLGSDDSLVDLFLFDATPHSLGVAAAGGAMAVMIPKN
TPIPVMARENTISIQPNHKKGIVISIFEGERPQASENTLLCEIETSGGSQQSKARSEALC
VCVLQHRCRRRLDGLCEGQGERA
NT seq 1512 nt   +upstreamnt  +downstreamnt
atgatggcagagacgggcgaccagcacggtccagtgatcggcatcgacctcggcacggcg
tgctcgtgcgtggccgtgtggcagaacggccgcgcggagatcgtgaccaacgaacatggc
gggcgggccacgccgtcgtacgcggcgttcaccgacacggagaggctcgtcggcgacgcg
gccaagagccaggcctcccggaaccccaccaacaccgtcttcgctacgaagcgattgatg
gggagaagattcagtgacgcgtccgtgcaggacggcctgaagctgtggccgttcaaggtt
gtcccgggccgtggcgacaagccgatggttgccgcgagctacaagggcaagcagaagctg
ctcgccgcggaggaggtcgcgtccatgctgctctcaaagatgaaggcagaggccgaggcc
tacatcggggggccagtcaagaacgccgtggtcacggtgcccgcgtcgttcgacgtcctc
cagcgccgggccaccaagcacgcatgcgccgtcgcggggctcgacgtcctcggcgtcatc
cacgggccagcggccgccgccgtcgcctttggcatccacgaaatcgcgggcgacaagaat
gtgctcgtctttgatcttggaggcggtcataccagcgtgtcactcctcgccgtcgcgtcc
ggcaagatcgccgtcagggcgaccgccggcgacccccaccttggcggcgaggatttcaac
ggccgcatggtcgaacacttcgtcgctcagttcaaggcagagcacaagaaagacgtcggt
cgcaacgcgagggctattttgaggctcagggcggcgtgcgagcaggcgaagaggacgctc
tcgtcggcgagctgggccgccattgagctcgaacgtttgcacgatggcgcagacttctac
tccaccattacgcgcgaccagttcgacgaactcaacctggacctgttctgcaagtgcttg
gatcccatcaagaagtgcctcacgggcgccaagatggacaggagcagcgtggacgacgtc
gtcttcgtcggcggatcaacccgaatccctcgcgtgcgccgtctgattcaggacctgttc
gacgggaaggagctccgcaaggacatcagctctgacgaggcggcggcgtgcggtgctgcc
accatggccagtctcggcagcgacgacagcttggtggacctgttcctattcgacgccacg
ccgcactcgctcggcgtggcggcggccggaggcgccatggcagtgatgataccaaagaac
accccgattcccgtcatggcgagggagaatactatctccatccagcccaatcacaagaaa
ggtattgttatctcaattttcgaaggagagaggccacaagcaagtgagaacactctcctc
tgcgagatcgaaacttccgggggctcacagcaaagcaaagcccggagtgaagctctctgt
gtctgtgtgcttcagcatcgatgccgacggcgtcttgacggtctctgcgagggacaaggt
gaacgggcataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107279546
Entry
107279546         CDS       T01015                                 
Name
(RefSeq) heat shock cognate 70 kDa protein-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
osa04141  Protein processing in endoplasmic reticulum
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107279546
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107279546
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107279546
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    107279546
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    107279546
   03009 Ribosome biogenesis [BR:osa03009]
    107279546
   03110 Chaperones and folding catalysts [BR:osa03110]
    107279546
   04131 Membrane trafficking [BR:osa04131]
    107279546
   03051 Proteasome [BR:osa03051]
    107279546
   03029 Mitochondrial biogenesis [BR:osa03029]
    107279546
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    107279546
Protein phosphatases and associated proteins [BR:osa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     107279546
Spliceosome [BR:osa03041]
 Complex B
  Other components
   Prp19 complex
    107279546
 Complex C
   Prp19-CDC5 complex
    107279546
Ribosome biogenesis [BR:osa03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    107279546
Chaperones and folding catalysts [BR:osa03110]
 Heat shock proteins
  HSP70 / DNAK
   107279546
Membrane trafficking [BR:osa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    107279546
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    107279546
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    107279546
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    107279546
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   107279546
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DUF1464
Other DBs
NCBI-GeneID: 107279546
NCBI-ProteinID: XP_015617948
LinkDB
Position
11:4448685..4451831
AA seq 594 aa
MAASNTSKKGGGGDGGGGGGPAIGIDLGTTYSCAAVRRHNRSEVITNDQGNRITPSCVAF
TADDRFVGDAAENQAALNPTNTIFEAKRLIGRRFSSKSVQEDIKLWPFKVVAGPDDRPTI
VVQHEGKEMQFVPEEISAMVLSKLRDAAVAYLGEPVTDAVITVPVYFNNAQREATLDAAA
IAGLNVMRIINEPSAAAIAYGLDKMPPPPASGGGAAVRTVLIFDLGGGTLDVSLLNIGRP
GNNSNSGDNGSSFEFEVKAVAGDTHLGGADFDNAMVNHCINEFIRKHDVAEEGIRSNQKA
IRRLRSACERAKRLLSFTAQTSIEVDSLHDGVDFCAKMSRSRFEELNKELFGRCVKAVEK
CLEDAKMDKGDVHDVVLVGGSSRIPKLQSMLHDFFQEKKLRHSVNPDEAVAYGAAIQASI
LNGDADDADDKKKAMILRDITPFSLGVEIYDENDHTMSVVIPRNTFIPAKNTQRYTTHRD
MQTSVSIKVFEGESASTKNNYLLGEFVLSGITPAPAGVARIDETLEIDANGVLHVSAEDM
GTGRKNSITITNHSGRLKKEDVERMSREARSYNRKRKRTRSSLQINSGNLVILE
NT seq 1785 nt   +upstreamnt  +downstreamnt
atggcggcctccaacaccagcaagaagggcggcggcggcgacggcggcggtggcggaggc
ccggcgatcggcatcgacctcgggacgacctactcgtgcgcggcggtgaggcggcacaac
cgcagcgaggtcatcaccaacgaccagggcaaccgcatcaccccctcctgcgtcgccttc
accgccgacgacaggttcgtcggcgacgccgccgagaatcaggccgccctcaaccccacc
aacaccatcttcgaagcgaagcgactgattggccgccggttcagcagcaaatctgtacaa
gaggacatcaagctttggccgttcaaagtcgtcgctggccctgacgacaggccgacgatc
gtggtgcagcatgagggcaaggagatgcagtttgtgcccgaggagatctccgccatggtg
ctctccaagttgagggacgccgccgtggcctacctcggcgagccggtcacggacgccgtc
atcaccgtccccgtctacttcaacaacgcccagcgcgaggccaccctcgacgccgccgcc
atcgccggcctcaatgtcatgcgcatcatcaacgagccctccgccgccgccatcgcctac
ggcctcgacaagatgccgccaccgccggccagcggcggcggtgcagctgtgaggacggtg
ctcatctttgatctcggtggcggaaccctcgacgtctccctccttaacattggtcgtccg
ggcaacaacagcaacagcggcgataatggcagcagcttcgagttcgaggtgaaggccgtc
gccggcgacactcacctcggcggcgccgacttcgacaacgcgatggtgaaccactgcatc
aacgagttcatccggaagcacgacgtggcggaagaaggcatcaggagcaaccagaaggcg
atccggaggctgaggtcggcgtgcgagagagccaagaggttgctgtccttcacggcgcag
accagcatcgaggtcgactcgctccacgacggcgtcgacttctgcgccaagatgagccgg
tcccggttcgaggagctcaacaaggagctcttcggcaggtgcgtcaaggccgtggagaag
tgcctcgaggacgccaagatggacaagggcgacgtgcacgacgtcgtgctcgtgggaggc
tccagccgcatccccaagctgcagagcatgctccacgacttcttccaggagaagaagctc
cgccacagcgtcaaccccgacgaggccgtcgcgtacggcgccgccatccaggcctccatc
ctcaacggcgacgccgacgacgccgacgacaagaagaaggcgatgatcctgcgcgacatc
acgcccttctcgctaggtgtcgagatctatgatgaaaatgatcatacaatgagcgtcgtg
atcccgaggaacaccttcattccggccaagaacacgcagcgctacaccacccaccgcgac
atgcagaccagcgtgagcatcaaggtgttcgagggcgagagcgcgagcaccaagaacaac
tacctgctcggcgagttcgttctctccggcatcaccccggcgcccgccggcgtagcccgt
atcgatgaaaccttagagattgatgccaacggcgtcctgcacgtgtccgcggaggacatg
ggcacggggaggaagaacagcatcaccatcaccaaccacagtgggcggctgaagaaggag
gacgtcgagcgcatgtcgcgggaggccaggagctacaaccggaagcgcaagcgcaccaga
tcatcgctccagataaattctgggaacctggtgatcttggagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327388
Entry
4327388           CDS       T01015                                 
Name
(RefSeq) probable mediator of RNA polymerase II transcription subunit 37c
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
osa04141  Protein processing in endoplasmic reticulum
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4327388
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4327388
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4327388
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    4327388
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4327388
   03009 Ribosome biogenesis [BR:osa03009]
    4327388
   03110 Chaperones and folding catalysts [BR:osa03110]
    4327388
   04131 Membrane trafficking [BR:osa04131]
    4327388
   03051 Proteasome [BR:osa03051]
    4327388
   03029 Mitochondrial biogenesis [BR:osa03029]
    4327388
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4327388
Protein phosphatases and associated proteins [BR:osa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     4327388
Spliceosome [BR:osa03041]
 Complex B
  Other components
   Prp19 complex
    4327388
 Complex C
   Prp19-CDC5 complex
    4327388
Ribosome biogenesis [BR:osa03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    4327388
Chaperones and folding catalysts [BR:osa03110]
 Heat shock proteins
  HSP70 / DNAK
   4327388
Membrane trafficking [BR:osa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    4327388
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    4327388
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    4327388
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    4327388
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4327388
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A Radial_spoke_3
Other DBs
NCBI-GeneID: 4327388
NCBI-ProteinID: XP_015618966
UniProt: A0A0P0VAE2 Q943K7
LinkDB
Position
1:36039687..36043154
AA seq 648 aa
MAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQ
VAMNPINTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVQYKGEEKQFSAE
EISSMVLIKMREIAEAYLGSNIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPT
AAAIAYGLDKKATSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDN
RMVNHFVLEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYS
TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFFN
GKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIP
RNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQIT
VCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKK
VDAKNALENYAYNMRNTIKDDKIASKLSADDKKKIEDAIDGAINWLDSNQLAEADEFEDK
MKELESICNPIIAKMYQGAGADMGGAAGMDEDAPAGGSGAGPKIEEVD
NT seq 1947 nt   +upstreamnt  +downstreamnt
atggcgaagggagagggcccggcgatcggcatcgacctcggcaccacctactcgtgcgtc
ggcgtgtggcagcacgaccgggtggagatcatcgccaacgaccaggggaaccgcaccacg
ccgtcgtatgtcgcgttcaccgactccgagcggctcatcggcgacgccgccaagaaccag
gtcgccatgaaccccatcaacaccgtcttcgatgccaagcgactgataggtaggcggttc
tccgacccgtccgtgcagagtgacatgaagctgtggccgttcaaggtcatccctggcccc
ggcgataagcctatgattgtggtgcagtacaagggcgaggagaagcagttctccgccgag
gagatctcctccatggtgctcatcaagatgagggagatcgctgaagcctacctcggctcc
aacatcaagaacgccgtggtgactgtgccggcctacttcaacgactcgcagaggcaggcc
accaaggacgccggtgtcattgccggcctcaacgtgatgcgcatcatcaacgagcccacc
gccgcggccatcgcctacggtcttgacaagaaggccaccagctccggcgagaagaacgtg
ctcatcttcgatcttggcggtggcacgttcgatgtgtcgctgctcaccattgaggagggc
attttcgaggtgaaggccactgctggtgacactcaccttggtggtgaggacttcgacaac
cgcatggtgaaccatttcgtcctggagttcaagcgcaagaacaagaaggacatcagcggc
aacccgcgtgctctgcgccggctgcgcacggcctgcgagcgcgccaagcgcacgctgtcg
tcgaccgcacagaccaccattgagatcgactccctgtacgagggcatcgacttctactcg
accatcaccagggctcgcttcgaggagctcaacatggacctgttccgcaagtgcatggag
ccggtggagaagtgcctgcgcgacgccaagatggacaagagcagcgtgcacgacgtcgtg
ctcgtcggcggctccacccgcatccccaaggtgcagcagctgcttcaggacttcttcaac
ggcaaggagctgtgcaagagcatcaaccccgacgaggccgtggcatacggcgccgctgtc
caggccgccatcctcagcggcgagggcaacgagaaggtgcaggacctgcttctgctcgac
gtcacgccgctgtcgctggggctcgagacagcaggaggtgtcatgaccgtgctcatcccg
aggaacaccaccatccccaccaagaaggagcaggtgttctcgacctactccgacaatcag
cctggcgtcctgatccaggtgtacgagggtgagcgtgcccggaccaaggacaacaacctg
ctgggcaagttcgagctctccggcatccctccagctccccgcggcgtgccccagatcacc
gtctgctttgacatcgacgccaatggcatcctcaacgtctctgccgaggacaagaccacc
gggcagaagaacaagatcaccatcaccaacgacaagggcaggctgagcaaggaggagatc
gagaagatggtgcaggaggcggagaagtacaaggcggaggacgaggagcacaagaagaag
gtggacgccaagaacgcgctcgagaactacgcctacaacatgaggaacaccatcaaggac
gacaagatcgcctccaagctctcggcggacgacaagaagaagatcgaggacgccatcgac
ggcgccatcaactggctcgacagcaaccagctcgcggaggcggacgagttcgaggacaag
atgaaggagctggagagcatctgcaaccccatcatcgcgaagatgtaccagggcgccggc
gcggacatgggcggcgccgctggcatggacgaggacgcgccggcgggtggcagcggtgca
ggccccaagatcgaggaggtcgattaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332413
Entry
4332413           CDS       T01015                                 
Name
(RefSeq) heat shock cognate 70 kDa protein 2
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
osa04141  Protein processing in endoplasmic reticulum
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4332413
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4332413
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4332413
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    4332413
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4332413
   03009 Ribosome biogenesis [BR:osa03009]
    4332413
   03110 Chaperones and folding catalysts [BR:osa03110]
    4332413
   04131 Membrane trafficking [BR:osa04131]
    4332413
   03051 Proteasome [BR:osa03051]
    4332413
   03029 Mitochondrial biogenesis [BR:osa03029]
    4332413
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4332413
Protein phosphatases and associated proteins [BR:osa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     4332413
Spliceosome [BR:osa03041]
 Complex B
  Other components
   Prp19 complex
    4332413
 Complex C
   Prp19-CDC5 complex
    4332413
Ribosome biogenesis [BR:osa03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    4332413
Chaperones and folding catalysts [BR:osa03110]
 Heat shock proteins
  HSP70 / DNAK
   4332413
Membrane trafficking [BR:osa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    4332413
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    4332413
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    4332413
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    4332413
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4332413
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A
Other DBs
NCBI-GeneID: 4332413
NCBI-ProteinID: XP_015630538
UniProt: A3AGK4 Q10NA9
LinkDB
Position
3:9370145..9373068
AA seq 650 aa
MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN
QVAMNPINTVFDAKRLIGRRFSDTSVQSDAKLWPFKVLPGPGDKPMIGVQYKGEEKQFSA
EEISSMVLNKMKETAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP
TAAAIAYGLDKKSSSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
NRMVNHFVQEFKRKNKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFY
TTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPRVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQAAILTGEGNEKVQDLLLLDVTPLSQGLETAGGVMTVLI
PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTKDNNLLGKFELSGIPPAPRGVPQI
TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKAEDEEHKK
KVDAKNSLENYAYNMRNTIKDDKIASKLPEADKKKIEDAIDGAISWLDSNQLAEAEEFED
KMKELEGVCNPIIAKMYQGAGADMAGGMDEDAPAAAGGSSGPGPKIEEVD
NT seq 1953 nt   +upstreamnt  +downstreamnt
atggccggcaagggagacgggccggcgatcggcatcgacctcgggacgacctactcgtgc
gtcggcgtgtggcagcacgaccgcgtcgagatcatcgccaacgaccaggggaaccgcacc
acgccgtcgtatgtcgcgttcaccgactccgagaggctcatcggcgacgccgccaagaac
caggtcgccatgaaccccatcaacaccgtcttcgatgcgaagcgtctcatcggccggcgt
ttctctgacacgtcggtgcagagcgacgcgaagctgtggccgttcaaggtgctacccggc
cccggcgacaagccgatgatcggcgtgcagtacaagggagaggagaagcagttctccgcc
gaggagatctcgtccatggtgctcaacaagatgaaggagacggccgaggcctatctcgga
agcaccgtcaagaacgccgtcgtcaccgtcccggcctacttcaacgactcccagcgccag
gccaccaaggacgccggcgtcatctccggcctcaacgtcatgcgcatcatcaacgagccc
accgccgccgccatcgcctacggcctcgacaagaagtcgagcagcgtcggcgagaagaac
gtgctcatctttgacctcggcggcggcacattcgatgtctccctcctcaccatcgaggag
ggcatcttcgaggtgaaggccaccgccggtgacacccaccttggaggcgaggacttcgac
aaccggatggtgaaccacttcgtgcaggaattcaagaggaagaacaagaaggacatcacg
ggcaacccgagggcgctcaggcgtctgaggacggcgtgcgagagggcgaagaggacgctg
tcctccaccgcccagaccaccatcgagatcgactccctctacgagggcatcgacttctac
accaccatcacccgcgccaggttcgaggagctcaacatggacctcttccgcaagtgcatg
gagcccgtggagaagtgcctccgcgacgccaagatggacaagagcaccgtccacgacgtc
gtgctcgtcggaggctccacccgtatcccccgcgtgcagcagctgctccaggacttcttc
aacgggaaggagctctgcaagagcatcaaccccgacgaggccgtcgcgtacggcgccgcc
gtgcaggccgccatcctcaccggcgagggcaacgagaaggtccaggacctgctcctcctc
gacgtcacgccgctgtctcagggcctcgagacggccggaggcgtcatgaccgtgctgatc
cccaggaacaccaccatccccaccaagaaggagcaggtcttctccacctactccgacaac
cagcccggcgtgctcatccaggtgtacgagggtgagaggacgcggaccaaggacaacaac
ctgctcggcaagttcgagctctccggcattccgccggcgcccaggggtgtcccccagatc
accgtgtgcttcgacattgacgcgaacggcatcctgaacgtctcggcggaggacaagacc
accgggcagaagaacaagatcaccatcaccaacgacaagggccgtctgagcaaggaggat
atcgagaagatggtgcaggaggcggagaagtacaaggcggaggacgaggagcacaagaag
aaggtcgacgccaagaactcgctcgagaactacgcctacaacatgcggaacaccatcaag
gacgacaagatcgcgtccaagctgccggaggccgacaagaagaagatcgaggacgccatc
gacggtgccatcagctggctcgacagcaaccagctcgccgaggccgaggagttcgaggac
aagatgaaggagctggagggcgtctgcaaccccatcatcgccaagatgtaccagggcgcc
ggagctgacatggccggaggcatggacgaggatgctccggcggccgccggcggaagcagc
ggaccagggcccaagatcgaggaagtcgactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332416
Entry
4332416           CDS       T01015                                 
Name
(RefSeq) heat shock cognate 70 kDa protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
osa04141  Protein processing in endoplasmic reticulum
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4332416
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4332416
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4332416
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    4332416
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4332416
   03009 Ribosome biogenesis [BR:osa03009]
    4332416
   03110 Chaperones and folding catalysts [BR:osa03110]
    4332416
   04131 Membrane trafficking [BR:osa04131]
    4332416
   03051 Proteasome [BR:osa03051]
    4332416
   03029 Mitochondrial biogenesis [BR:osa03029]
    4332416
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4332416
Protein phosphatases and associated proteins [BR:osa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     4332416
Spliceosome [BR:osa03041]
 Complex B
  Other components
   Prp19 complex
    4332416
 Complex C
   Prp19-CDC5 complex
    4332416
Ribosome biogenesis [BR:osa03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    4332416
Chaperones and folding catalysts [BR:osa03110]
 Heat shock proteins
  HSP70 / DNAK
   4332416
Membrane trafficking [BR:osa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    4332416
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    4332416
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    4332416
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    4332416
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4332416
SSDB
Motif
Pfam: HSP70 MreB_Mbl Hydantoinase_A RGS12_us2 FGGY_C
Other DBs
NCBI-GeneID: 4332416
NCBI-ProteinID: XP_015630539
UniProt: A3AGK6 Q10NA5
LinkDB
Position
3:complement(9377857..9382773)
AA seq 560 aa
MGFLPGDDDGPAVGIDLGTTYSCVAVWRRGRVEVIPNDQGNLTTPSCVAFTDTWRLIGDA
ALNQAAMNPLNTIFDAKRLIGRRFSDVSVQGDIKLWPFKVTSGKDDRPMIVVQYRGEEKE
FSAEEISAMVLFKMKETAEAYLDKTVEKAVITVPVYFNDSQRQATMDAGAVAGLDVLRII
NEPTAAAVAYGLDKVVGSSDKKKRVLIFDLGGGTLDVSVLNIDPGVDIDIGIFEVKATAG
DTHLGGEDFNGRMVKHLVREFLRKYKRPEIRGDQRALRRLRTACEKAKRMLSSTAQTTIE
IDSLHGGVDFHATVTRAKFEELNMDLFLECMDTVKQCLRDAGTDKGTVDDVVLVGGSTRI
PKVRSLLQDLFDGKALCRSINPDEAVAHGAAVKAALLNGDANEKDLRDVVLLDVTPLSLG
IEVFGGGMSVLIPRNTTIPVSRQKMYTTHYDNETAVLINVNEGEGRRTKDNNPLGKFVLT
GIPPAPRGVPQINVTFSIDYNGIMNVSAEDKTTGRSNSITIKSDKGRLSKEEIERMVKKA
EKYKAEDEEEMKKAEGYVAP
NT seq 1683 nt   +upstreamnt  +downstreamnt
atggggtttctgccgggcgacgacgacgggccggcggtcggcatcgacctcgggacgacg
tactcgtgcgtggccgtgtggcggcgcggccgcgtggaggtgatccccaacgaccagggc
aacctcaccacgccgtcctgcgtcgccttcaccgacacctggcgcctcatcggcgacgcc
gccttgaaccaggccgccatgaatcccctcaacaccatcttcgatgcgaagcgattgatc
ggccggcgattcagcgacgtgtccgtgcagggagatatcaagctatggcctttcaaggtc
acctccggcaaggacgaccggccgatgatcgtggtgcagtacaggggcgaggagaaggag
ttctccgccgaggagatctccgccatggtgctcttcaagatgaaggagaccgccgaggcc
tacctcgacaagacggtcgagaaggccgtcatcaccgtgccggtctacttcaacgactcc
cagcgccaggccaccatggacgccggcgccgtcgccggcctcgacgtcctgcgcatcatc
aacgagcccaccgccgccgccgtcgcctacggcctcgacaaggtggtcggcagcagcgac
aagaagaagagagtgctgatatttgacctcggcggcggcaccctggacgtgtccgtcctc
aacatcgaccccggggtggacatcgacataggcatcttcgaggtgaaggccaccgccggc
gacacccacctcggcggcgaggatttcaatggcaggatggtgaagcacctggttcgggag
ttcctgaggaagtacaagaggccggagatcaggggcgaccagagggcgctccggcggctg
aggacggcgtgcgagaaggcgaagaggatgctgtcctccacggcgcagaccaccatcgag
atcgactcgctccacggcggcgtcgacttccacgcgaccgtcacacgggccaagttcgag
gagctcaacatggacctcttcctcgagtgcatggacaccgtcaagcagtgcctccgcgac
gccgggacggacaagggcaccgtcgacgacgtcgtgctcgtcggaggctccacccgcatc
cccaaggtgcggagcctgctccaggacctgttcgacggcaaggcgctctgcaggagcatc
aaccccgacgaggccgtcgcgcacggcgccgccgtcaaggccgccctcctcaacggcgac
gccaacgagaaggaccttcgcgacgtggtccttctcgacgtcacgccgctgtcgctcggg
atagaggtattcggtggcgggatgtcggtgttgatcccgaggaacaccaccatccccgta
agcaggcagaaaatgtacactacccactacgacaacgagaccgccgtgctcatcaacgtg
aacgagggcgaaggccgaagaaccaaggataacaacccgctcggcaagtttgttctcacc
ggcatcccaccggcgccgaggggcgtgccccagatcaacgtcaccttcagcattgattat
aacggcatcatgaacgtgtccgcggaggacaagacgacgggacgcagcaacagcatcacc
atcaagagcgacaaggggaggctgagcaaggaggagatcgagaggatggtgaagaaggcc
gagaagtacaaggccgaggatgaggaggagatgaagaaagctgaaggctatgtggcaccc
taa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332420
Entry
4332420           CDS       T01015                                 
Name
(RefSeq) heat shock cognate 70 kDa protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
osa04141  Protein processing in endoplasmic reticulum
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4332420
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4332420
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4332420
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    4332420
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4332420
   03009 Ribosome biogenesis [BR:osa03009]
    4332420
   03110 Chaperones and folding catalysts [BR:osa03110]
    4332420
   04131 Membrane trafficking [BR:osa04131]
    4332420
   03051 Proteasome [BR:osa03051]
    4332420
   03029 Mitochondrial biogenesis [BR:osa03029]
    4332420
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4332420
Protein phosphatases and associated proteins [BR:osa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     4332420
Spliceosome [BR:osa03041]
 Complex B
  Other components
   Prp19 complex
    4332420
 Complex C
   Prp19-CDC5 complex
    4332420
Ribosome biogenesis [BR:osa03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    4332420
Chaperones and folding catalysts [BR:osa03110]
 Heat shock proteins
  HSP70 / DNAK
   4332420
Membrane trafficking [BR:osa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    4332420
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    4332420
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    4332420
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    4332420
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4332420
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Radial_spoke_3 DDR Hydantoinase_A
Other DBs
NCBI-GeneID: 4332420
NCBI-ProteinID: XP_015630928
UniProt: Q10NA1 A0A8J8XYD9
LinkDB
Position
3:complement(9411548..9416117)
AA seq 653 aa
MAGNKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
NQVAMNPTNTVFDAKRLIGRRFSDPSVQADMKMWPFKVVPGPADKPMIVVTYKGEEKKFS
AEEISSMVLTKMKEIAEAFLSTTIKNAVITVPAYFNDSQRQATKDAGVISGLNVMRIINE
PTAAAIAYGLDKKAASTGEKNVLIFDLGGGTFDVSILTIEEGIFEVKATAGDTHLGGEDF
DNRMVNHFVQEFKRKHKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDF
YATITRARFEELNMDLFRRCMEPVEKCLRDAKMDKAQIHDVVLVGGSTRIPKVQQLLQDF
FNGKELCKSINPDEAVAYGAAVQAAILSGEGNQRVQDLLLLDVTPLSLGLETAGGVMTVL
IPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTKDNNLLGKFELTGIPPAPRGVPQ
INVTFDIDANGILNVSAEDKTTGKKNKITITNDKGRLSKEEIERMVQEAEKYKAEDEQVR
HKVEARNALENYAYNMRNTVRDEKIASKLPADDKKKIEDAIEDAIKWLDGNQLAEADEFE
DKMKELESLCNPIISKMYQGGAGGPAGMDEDAPNGSAGTGGGSGAGPKIEEVD
NT seq 1962 nt   +upstreamnt  +downstreamnt
atggcgggcaacaagggagagggccctgcgatcggcatcgacctcggcacgacctactcg
tgcgtcggcgtgtggcagcatgacagggtggagatcatcgccaacgaccagggcaaccgc
accacgccgtcgtacgtggccttcaccgacaccgagaggctcatcggcgacgccgccaag
aaccaggtcgccatgaaccccaccaacaccgtctttgatgcaaagcggctgatcgggcgg
cgcttctcggacccgtcggtgcaggcggacatgaagatgtggccgttcaaggtggtgcct
ggcccagccgacaagccgatgatcgtggtgacgtacaagggcgaggagaagaagttctcg
gcggaggagatctcgtccatggtgctcaccaagatgaaggagatcgccgaggccttcctc
agcaccaccatcaagaacgccgtcatcaccgtcccggcctacttcaacgactcccaacgc
caggccaccaaggacgccggcgtcatctccggactcaacgtcatgcgcatcatcaacgag
cccaccgccgccgccatcgcctacggcctcgacaagaaggccgccagcaccggcgagaag
aatgtcctcatcttcgacctcggcggcggcaccttcgacgtctccatcctcaccatcgag
gagggcatcttcgaggtcaaggccaccgccggcgacacccacctgggaggcgaggacttc
gacaaccggatggtgaaccacttcgtgcaggagttcaagaggaagcacaagaaggacatc
accggcaacccgagggcgctccggcggctgaggacggcgtgcgagagggcgaagaggacg
ctgtcctccaccgcccagaccaccatcgagatcgactcgctctacgagggcatcgacttc
tacgccaccatcacccgcgcccgcttcgaggagctcaacatggacctcttccgccggtgc
atggagcccgtggagaagtgcctccgcgacgccaagatggacaaggcccagatccacgat
gtcgtcctcgtcggaggctccacccgtatccccaaggtgcagcagctcctgcaggacttc
ttcaacgggaaggagctctgcaagagcatcaaccccgacgaggccgtggcgtacggcgcc
gccgtccaggccgccatcctcagcggcgagggcaaccagagggtgcaggacctgctcctc
ctcgacgtcacgccgctctcgctcgggttggagacggccgggggtgtcatgaccgtgctg
atcccgaggaacaccaccatcccaaccaagaaggagcaggtcttctccacctactccgac
aaccagcccggcgtgctcatccaggtgtacgagggcgagaggacgaggaccaaggacaac
aacctgctcggcaagttcgagctcaccggcatcccgccggcgccgaggggcgtgccccag
atcaacgtgacgttcgacatcgacgcgaacggcatcctgaacgtgtcggcggaggacaag
acgacggggaagaagaacaagatcaccatcaccaacgacaaggggcggctgagcaaggag
gagatcgagcggatggtgcaggaggccgagaagtacaaggccgaggacgagcaggtgcgg
cacaaggtggaggcccgcaacgcgctggagaactacgcgtacaacatgcgcaacacggtg
cgcgacgagaagatcgcctccaagctccccgccgacgacaagaagaagatcgaggacgcc
atcgaggatgccatcaagtggctcgacggcaaccagctcgccgaggccgacgagttcgag
gacaagatgaaggagctcgagagcctctgcaatccgatcatctcaaagatgtaccagggc
ggcgccggtggtccggcgggcatggacgaagacgcccccaacggcagtgccggcaccggc
ggtggcagcggcgctggccccaagatcgaggaagtggactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334598
Entry
4334598           CDS       T01015                                 
Name
(RefSeq) heat shock cognate 70 kDa protein 2
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
osa04141  Protein processing in endoplasmic reticulum
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4334598
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4334598
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4334598
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    4334598
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4334598
   03009 Ribosome biogenesis [BR:osa03009]
    4334598
   03110 Chaperones and folding catalysts [BR:osa03110]
    4334598
   04131 Membrane trafficking [BR:osa04131]
    4334598
   03051 Proteasome [BR:osa03051]
    4334598
   03029 Mitochondrial biogenesis [BR:osa03029]
    4334598
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4334598
Protein phosphatases and associated proteins [BR:osa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     4334598
Spliceosome [BR:osa03041]
 Complex B
  Other components
   Prp19 complex
    4334598
 Complex C
   Prp19-CDC5 complex
    4334598
Ribosome biogenesis [BR:osa03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    4334598
Chaperones and folding catalysts [BR:osa03110]
 Heat shock proteins
  HSP70 / DNAK
   4334598
Membrane trafficking [BR:osa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    4334598
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    4334598
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    4334598
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    4334598
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4334598
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A
Other DBs
NCBI-GeneID: 4334598
NCBI-ProteinID: XP_015631367
UniProt: A3AP50 Q84TA1
LinkDB
Position
3:34446310..34450760
AA seq 649 aa
MAPTKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK
NQVAMNPINTVFDAKRLIGRRFSDASVQSDIKMWPYKVIPGPGDKPMIVVQYKGEEKQFS
AEEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINE
PTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDF
DNRLVNHFVQEFKRKHKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGVDF
YSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPRVQQLLQDF
FNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVL
IPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQ
ITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEEHK
KKVDAKNSLENYAYNMRNTIQDEKIASKLPADDKKKIEDAVEQAIQWLDNNQLAEVEEFE
DKMKELEGLCNPIIAKMYQGAGADMGGGMDDDAPAAGGSGAGPKIEEVD
NT seq 1950 nt   +upstreamnt  +downstreamnt
atggcgccgaccaagggggaggggccagcgatcggcatcgacctcgggacgacctactcg
tgcgtgggggtgtggcagcacgaccgcgtcgagatcatcgccaacgaccaggggaaccgc
accaccccctcctacgtcgggttcacggacaccgagcgcctcatcggggatgccgccaag
aaccaggtcgccatgaaccccatcaacaccgtcttcgatgccaagcgtcttatcggcaga
cggttttctgatgcctctgtccagagcgatatcaagatgtggccttacaaggttattcct
ggcccaggggataagcctatgattgtagtgcagtacaagggtgaggagaagcaattctct
gccgaagaaatttcatccatggttcttatcaagatgcgtgagatcgctgaagcttaccta
gggtcaactgtgaagaatgctgttgtcactgttcctgcatacttcaatgattcccagagg
caggcaactaaagatgcaggtgttattgcgggtcttaatgttatgcgtatcatcaatgag
ccaacagctgctgcaattgcttatggtcttgacaagaaggcgactagtgttggtgagaag
aacgtgctcatttttgaccttggtggtggtacttttgatgtctccctccttaccattgag
gagggtatttttgaggtgaaagcaacagctggtgacactcaccttggtggggaggacttt
gacaaccgcctggtgaaccactttgtccaagagttcaagagaaagcataagaaggatatc
agcgggaaccccagggctttgaggaggctcagaacatcatgtgaaagggcaaagaggacc
ctctcctccactgcccaaactactattgaaattgattccctctttgagggtgttgatttc
tattccaccatcaccagagccaggtttgaggagcttaacatggacctcttcaggaaatgt
atggagcctgtggagaagtgcctgagggatgcaaagatggacaagagcactgtccatgat
gttgtccttgttggtggttcaactagaatccctagggttcagcagcttctgcaggatttc
ttcaatgggaaggaactctgcaagagcattaaccctgatgaagctgtggcatacggtgct
gccgtccaggctgctatccttagtggagaggggaacgagaaggtgcaggatcttcttctc
cttgatgtgactccactgtctcttggtctcgagacagcgggaggtgtgatgacagtgctc
atcccaaggaacaccaccattcctaccaagaaggagcaggtcttctccacctactccgat
aaccagcctggtgtgttgattcaggtctatgagggtgagaggacacggaccagggacaac
aatctccttggcaaatttgagctgtctggaatccctcctgcccctaggggagtccctcag
atcactgtctgctttgacattgatgccaacggtatcctgaatgtgtctgccgaagacaag
acaactggccagaagaacaagataaccatcacaaatgacaagggaaggctgagcaaagag
gagatagagaagatggttcaggacgccgagaagtacaagtccgaggatgaagagcacaaa
aagaaagttgacgccaagaattccctggagaactatgcttacaacatgaggaacactatc
caagacgagaagattgcttccaagctgccagctgacgacaagaaaaagattgaggacgcg
gtcgagcaggcgatccagtggctggacaacaaccagctcgctgaggttgaagagttcgaa
gacaagatgaaggagctggagggcctgtgcaacccaattattgccaagatgtaccagggt
gctggtgccgacatgggtggtggaatggacgatgatgctccggctgctggtgggagtggt
gctggccctaagattgaggaggtcgactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338354
Entry
4338354           CDS       T01015                                 
Name
(RefSeq) stromal 70 kDa heat shock-related protein, chloroplastic
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
osa04141  Protein processing in endoplasmic reticulum
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4338354
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4338354
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4338354
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    4338354
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4338354
   03009 Ribosome biogenesis [BR:osa03009]
    4338354
   03110 Chaperones and folding catalysts [BR:osa03110]
    4338354
   04131 Membrane trafficking [BR:osa04131]
    4338354
   03051 Proteasome [BR:osa03051]
    4338354
   03029 Mitochondrial biogenesis [BR:osa03029]
    4338354
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4338354
Protein phosphatases and associated proteins [BR:osa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     4338354
Spliceosome [BR:osa03041]
 Complex B
  Other components
   Prp19 complex
    4338354
 Complex C
   Prp19-CDC5 complex
    4338354
Ribosome biogenesis [BR:osa03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    4338354
Chaperones and folding catalysts [BR:osa03110]
 Heat shock proteins
  HSP70 / DNAK
   4338354
Membrane trafficking [BR:osa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    4338354
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    4338354
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    4338354
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    4338354
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4338354
SSDB
Motif
Pfam: HSP70 MreB_Mbl FtsA StbA FGGY_C PilM_2 DUF5877 Phage_Gp23 Hydantoinase_A
Other DBs
NCBI-GeneID: 4338354
NCBI-ProteinID: XP_015639965
UniProt: B9FK56
LinkDB
Position
5:13621759..13627141
AA seq 689 aa
MATTTFPTSTPFFAHHGRRRPSPSVSVRTAAAVYGRGGGRRWRPLRVACEKVVGIDLGTT
NSAVAAMEGGKPTIVTNAEGARTTPSVVAYTKSGDRLVGQIAKRQAVVNPENTFFSVKRF
IGRKMNEVDEESKQVSYRVIRDDNGNVKLDCPAIGKQFAAEEISAQVLRKLVDDASKFLN
DKVTKAVITVPAYFNDSQRTATKDAGRIAGLEVLRIINEPTAASLAYGFEKKNNETILVF
DLGGGTFDVSVLEVGDGVFEVLSTSGDTHLGGDDFDKRVVDWLAGNFKNDEGIDLLKDKQ
ALQRLTEAAEKAKMELSSLTQTNISLPFITATADGPKHIETTLTRAKFEELCSDLLDRLR
TPVDNALRDAKLSFKDIDEVILVGGSTRIPAVQDLVKKMTGKDPNVTVNPDEVVALGAAV
QAGVLSGDVSDIVLLDVTPLSLGLETLGGVMTKIIPRNTTLPTSKSEVFSTAADGQTSVE
INVLQGEREFVRDNKSLGSFRLDGIPPAPRGVPQIEVKFDIDANGILSVSAVDKGTGKKQ
DITITGASTLPKDEVEKMVEEAEKFAKEDKEKRDAIDTKNQAESVIYQTEKQLKELGDKV
PGDVKGKVEAKLTELKDAVAGGSTQTMKDALAALNQEVMQLGQALYSQQGAPGAGPTPGA
DAAAGSAGPSEKPGGEEGDVIDADFTDSQ
NT seq 2070 nt   +upstreamnt  +downstreamnt
atggcgaccacgaccttccccacctcgacccccttcttcgcccaccatggcaggcggcgg
ccgtccccgtccgtctccgtccgcaccgccgccgcggtgtacgggcgcggcgggggccgg
aggtggcggccgctgcgggtggcgtgcgagaaggtggtcgggatcgacctcgggaccacc
aactccgcggtggcggccatggagggcggcaagccgacgatcgtcaccaacgccgagggc
gcccgcaccacgccgtcggtcgtcgcctacaccaagtccggtgaccggctggtggggcag
atcgccaagcgacaggcggtcgtcaacccggagaacaccttcttctccgtcaagcgcttc
atcggccgcaagatgaacgaagtcgacgaggagtccaagcaggtctcctaccgcgtcatc
agggacgacaacggcaacgtcaagctcgactgtcccgccattggcaagcagttcgccgcc
gaggagatctccgcccaggtgcttagaaagctggtggatgatgcatcaaagttcttgaac
gataaagtcacaaaggcagtgatcacagtcccagcatatttcaatgactcacaaaggaca
gcaacaaaagatgctggccggattgctgggttggaagttctccgcatcataaacgagcct
actgcagcatctttggcatatgggtttgaaaagaagaacaatgagaccattcttgttttt
gacctgggaggaggcacatttgatgtttcagttcttgaagttggtgatggtgtttttgag
gtgctgtctacatctggtgacactcaccttggtggtgatgactttgacaagagggttgtt
gattggctggcggggaacttcaagaatgatgaaggtattgacctactaaaagacaagcag
gccttgcaacgtcttacagaagcagctgagaaggcaaagatggagctatcatccttgacc
caaacaaatatcagtttacccttcattacagctactgctgatgggcccaagcatatcgag
acaactcttaccagggctaaatttgaggagctatgttcagatcttcttgacaggttgagg
acccctgtggacaatgccctcagagatgcaaagttgtcatttaaagacatagatgaggtg
atccttgtcggtggctccaccagaattccagctgtgcaggatcttgtgaagaaaatgact
ggaaaggaccccaatgtgactgtcaaccctgatgaggttgttgcacttggagcagctgtt
caggcaggagtgttgtctggtgatgtgagcgacattgttcttcttgatgtaacaccactt
tctctgggtttggagacactgggtggtgtgatgaccaagattatcccaaggaacacaact
ttgcccacctccaagtcagaggtcttctcaaccgctgctgatggccagactagcgtggag
atcaatgtcctccaaggagagagagagtttgtcagggacaacaaatctcttggtagcttt
cggcttgatggaattcctcctgccccacggggtgttccacaaatcgaagttaagtttgac
atcgatgccaatggcatcctttctgtcagcgccgtagacaagggtactggaaagaagcag
gacattacgataactggtgccagcacattgccgaaggatgaggtggagaagatggttgaa
gaagcagagaagtttgccaaggaggacaaagagaagagggacgcaatcgacaccaagaac
caggcagagtctgtcatctaccagactgagaaacaattgaaggagctcggtgacaaggtc
ccaggcgatgtgaagggtaaggttgaggcgaagctgacggagctcaaggacgctgttgca
ggtggctcgacacagacgatgaaggatgctctcgctgctctgaaccaggaagtgatgcag
ctggggcaggccctctacagccagcagggtgccccaggagcaggacctaccccaggagct
gatgctgccgctggctctgctggcccatccgagaagccaggaggcgaggaaggtgatgtc
atcgatgctgattttacagacagccaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339012
Entry
4339012           CDS       T01015                                 
Name
(RefSeq) probable mediator of RNA polymerase II transcription subunit 37c
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
osa04141  Protein processing in endoplasmic reticulum
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4339012
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4339012
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4339012
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    4339012
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4339012
   03009 Ribosome biogenesis [BR:osa03009]
    4339012
   03110 Chaperones and folding catalysts [BR:osa03110]
    4339012
   04131 Membrane trafficking [BR:osa04131]
    4339012
   03051 Proteasome [BR:osa03051]
    4339012
   03029 Mitochondrial biogenesis [BR:osa03029]
    4339012
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4339012
Protein phosphatases and associated proteins [BR:osa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     4339012
Spliceosome [BR:osa03041]
 Complex B
  Other components
   Prp19 complex
    4339012
 Complex C
   Prp19-CDC5 complex
    4339012
Ribosome biogenesis [BR:osa03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    4339012
Chaperones and folding catalysts [BR:osa03110]
 Heat shock proteins
  HSP70 / DNAK
   4339012
Membrane trafficking [BR:osa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    4339012
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    4339012
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    4339012
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    4339012
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4339012
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A
Other DBs
NCBI-GeneID: 4339012
NCBI-ProteinID: XP_015640166
UniProt: B9FJH8 Q6L509
LinkDB
Position
5:complement(22599466..22602601)
AA seq 646 aa
MSKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
VAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVVPGPGDKPMIVVQYKGEEKQFAAE
EISSMVLIKMREIAEAYLGSSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPT
AAAIAYGLDKKATSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDN
RMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYT
TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFFN
GKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIP
RNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQIN
VCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKK
VDAKNALENYAYNMRNTIKDEKIASKLAADDKKRIEDAIDGAISWLDTNQLAEADEFEDK
MKELEGICNPIIAKMYQGPGADMAGGMDEDAPAGGSGAGPKIEEVD
NT seq 1941 nt   +upstreamnt  +downstreamnt
atgtcgaagggggaagggccggcgatcgggatcgacctggggacgacctactcgtgcgtg
ggcgtgtggcagcacgaccgcgtggagatcatcgccaacgaccaggggaaccggaccacg
ccgtcgtacgtcgccttcaccgacaccgagcggctcatcggcgacgccgccaagaaccag
gtcgccatgaacccaaccaacaccgtcttcgatgcgaagcggttgattggtaggaggttc
tccgacccgtccgtgcagagtgacatgaagctatggccgttcaaggtggtgcctggcccc
ggcgacaagccgatgatcgtcgtccagtacaagggcgaggagaagcagttcgccgcggag
gagatctcgtccatggtgctgatcaagatgagggagatcgcggaggcctacctcggctcg
tccatcaagaacgccgtggtcaccgtcccggcctacttcaacgactcgcagaggcaggcc
accaaggacgccggcgtcatcgccgggctcaacgtgatgcgcatcatcaacgagcccacc
gccgccgccatcgcgtacggcctcgacaagaaggcgacgagcagcggcgagaagaacgtg
ctcatctttgacctcggcggcggcacgttcgacgtgtcgctgctcaccatcgaggagggc
atcttcgaggtcaaggccaccgccggcgacacccacctcggcggcgaggacttcgacaac
cgcatggtgaaccacttcgtgcaggagttcaagcgcaagaacaagaaggacatcagcggc
aacccgcgcgcgctgcggcggctcaggacggcgtgcgagcgcgccaagcgcacgctgtcg
tcgacggcgcagaccaccattgagatcgactcgctgtacgagggcatcgacttctacacg
acgatcaccagggcgcggttcgaggagctcaacatggacctgttccgcaagtgcatggag
cccgtggagaagtgcctccgcgacgccaagatggacaagagcagcgtgcacgacgtcgtg
ctcgtcggcggctccacccgcatccccaaggtgcagcaactgctccaggacttcttcaac
ggcaaggagctctgcaagagcatcaaccccgacgaggccgtggcgtacggcgccgccgtc
caggccgccatcctgagcggcgagggcaacgagaaggtgcaggacctgctcctgctcgac
gtcaccccgctgtccctcggcctcgagaccgccggcggcgtcatgaccgtgctcatcccg
aggaacaccaccatcccgaccaagaaggagcaggtcttctccacctactccgacaaccag
cccggcgtcctgatccaggtgtacgagggcgagcgcgccaggaccaaggacaacaacctc
ctcggcaagttcgagctctccggcatcccaccggcgccgcgcggcgtgccccagatcaac
gtctgcttcgacatcgacgccaacggcatcctgaacgtgtccgcggaggacaagacgacg
gggcagaagaacaagatcaccatcaccaacgacaaggggcggctgagcaaggaggagatc
gagaagatggtgcaggaggcggagaagtacaaggccgaggacgaggagcacaagaagaag
gtggacgccaagaacgccctcgagaactacgcctacaacatgcgcaacaccatcaaggac
gagaagatcgcctccaagctcgccgccgacgacaagaagaggatcgaggacgccatcgat
ggcgccatcagctggctcgacaccaaccagctcgccgaggccgacgagttcgaggacaag
atgaaggagctggagggcatctgcaacccgatcatcgccaagatgtaccagggccccggc
gccgacatggccggaggcatggacgaggacgcgccggcgggcggcagcggcgcaggcccc
aagatcgaggaggtcgactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349971
Entry
4349971           CDS       T01015                                 
Name
(RefSeq) heat shock cognate 70 kDa protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
osa04141  Protein processing in endoplasmic reticulum
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4349971
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4349971
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4349971
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    4349971
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4349971
   03009 Ribosome biogenesis [BR:osa03009]
    4349971
   03110 Chaperones and folding catalysts [BR:osa03110]
    4349971
   04131 Membrane trafficking [BR:osa04131]
    4349971
   03051 Proteasome [BR:osa03051]
    4349971
   03029 Mitochondrial biogenesis [BR:osa03029]
    4349971
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4349971
Protein phosphatases and associated proteins [BR:osa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     4349971
Spliceosome [BR:osa03041]
 Complex B
  Other components
   Prp19 complex
    4349971
 Complex C
   Prp19-CDC5 complex
    4349971
Ribosome biogenesis [BR:osa03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    4349971
Chaperones and folding catalysts [BR:osa03110]
 Heat shock proteins
  HSP70 / DNAK
   4349971
Membrane trafficking [BR:osa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    4349971
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    4349971
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    4349971
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    4349971
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4349971
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C
Other DBs
NCBI-GeneID: 4349971
NCBI-ProteinID: XP_015617949
UniProt: Q2R9K4 Q0IU44
LinkDB
Position
11:4443170..4446251
AA seq 577 aa
MAASNTTKKGGGGGGPAIGIDLGTTYSCVAVRRRYRSEAITNDQGNRITPSCVAFTAADR
FVGDAAENQAALNPTNTIFEVKRLIGRRFSDKSVQEDIKLWPFKVIAGRDDRPTIVVRHE
GKEKQFVPEEISAMVLSKLRDAAVAYLGEPVTDAVITVPVYFNNAQREATLDAATIAGLN
VMRIINEPSAAALAYGLDKMPPASGGAGRMVLIFDLGGGTLDVSLLNIGRPGNNNSSDSG
SFEFEVKAVAGDTHLGGADFNNAIVKHCINEFIRKHGVAAEGIWSNQKAIRRLRTACERA
KRMLSFTTLASIEVDSLHDGIDFCGKMSRSRFEELNKELFGKCVKAVKKCLEDAKMDKNA
VDDVVLVGGSSRIPKLQSMIHDFFDEKKLRRNVNPDEAVAYGAAIQASVLNGDADEADDK
KQVMILRDITPLSLGIEVGLDHTMSVVIPRNTFIPTKNVRRYSTIFDNQIAVSINVFEGE
SASILRNNLLGKFVLSGILPAPRGVPQIDVTFEFDANGVLHVSAKDMGTGSKNNIAITNH
SGRLKKEDVERMAREARSYNRTRSSLAITSGNLVIFQ
NT seq 1734 nt   +upstreamnt  +downstreamnt
atggcggcctccaacaccaccaagaagggcggcggcggcggcggcccggcgatcggcatc
gacctcgggacgacctactcgtgcgtggccgtgaggcggcgctaccgcagcgaggccatc
accaacgaccagggcaaccgcatcaccccctcctgcgtcgccttcaccgccgccgaccgg
ttcgtcggcgacgccgccgagaatcaggccgcgctcaaccccaccaacaccatcttcgaa
gtgaagcgactgatcggccgccggttcagcgataagtctgtacaagaggacatcaagctt
tggcctttcaaagtcattgctggccgtgacgaccggccaacgatcgtggtccgccatgag
ggcaaggagaagcagttcgtccccgaggagatctccgccatggtgctctccaagctgagg
gacgccgccgtggcctacctcggcgagccggtcacggacgccgtcatcaccgtccccgtc
tacttcaacaacgcccagcgcgaggccaccctcgacgccgccaccatcgctggcctcaac
gtcatgcgcatcatcaacgagccctccgccgccgccctcgcctatggcctcgacaagatg
ccgccggccagcggcggtgcagggaggatggtgctcatctttgatcttggtggcggcacc
ctggatgtctccctccttaacattggtcgtccgggcaacaacaacagcagcgacagcggc
agcttcgagttcgaggtgaaggccgtcgccggcgacactcacctcggcggcgccgacttc
aacaacgcgattgtgaagcactgcatcaacgagttcatcaggaagcacggcgtggcagca
gaaggcatctggagcaaccagaaggcgatcaggaggctgaggaccgcgtgcgagagagcc
aagaggatgctgtctttcacgacgcttgccagcatcgaggtcgactcgcttcacgacggc
atcgacttctgcggcaagatgagccggtcccggttcgaggagctgaacaaggagctcttc
ggcaagtgcgtcaaggccgtgaagaagtgcctcgaggacgccaagatggacaagaacgcc
gtggacgacgtcgtgctcgtgggcggctccagccgcatccccaagctgcagagcatgatc
cacgacttcttcgacgagaaaaagctccgcaggaacgtcaaccccgacgaggccgtcgcg
tacggcgccgccatccaggcctccgtcctcaacggcgacgccgacgaagccgacgacaag
aagcaggtgatgatcctgcgcgacatcacgcccctctcgctggggatcgaggtcggtctc
gatcacacgatgagcgtcgtgatcccgaggaacaccttcatcccgaccaagaacgtgcgg
cgttactccaccatattcgacaatcagatcgccgtgagcatcaatgtgttcgaaggagag
agcgcgagcatcctccgcaacaacctgctcggcaagtttgtgctgtccggcatcctcccg
gcgcccaggggagtgccccagatcgacgtcacgttcgagttcgacgccaatggcgtcctg
cacgtgtccgcgaaggacatgggcactgggagcaagaacaacatcgccattaccaaccac
agcggccggctgaagaaggaggacgtcgaacgcatggcgcgggaggccaggagctacaac
aggaccagatcatctctagcgataacttctgggaacctggtgatctttcaatga

DBGET integrated database retrieval system