KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107275870
Entry
107275870         CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S18-like
  KO
K02964  small subunit ribosomal protein S18e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    107275870
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    107275870
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    107275870
SSDB
Motif
Pfam: Ribosomal_S13 DUF2746 DUF6241
Other DBs
NCBI-GeneID: 107275870
NCBI-ProteinID: XP_015646147
UniProt: A0A0P0X2Z9
LinkDB
Position
7:3883503..3885559
AA seq 126 aa
MFALTSIKGIGRRFSNIACKKADIDMNKRAGELTPEELERLMTVVANPRQFKVPDWFLNR
KKDYKDGRFSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTV
GVSKKR
NT seq 381 nt   +upstreamnt  +downstreamnt
atgttcgcgctcacctccatcaagggtatcggccgccgcttctccaacattgcctgcaag
aaggccgacatcgacatgaacaagcgggctggtgaactcactcctgaggagcttgagcgc
ctcatgactgtggtggcaaaccctcgccagttcaaggtccctgactggtttctgaacagg
aagaaggactacaaggatgggaggttctcccaggttgtttctaacgccctggacatgaag
ctcagggatgaccttgagaggctgaagaagatcaggaaccaccgtggtctccgtcactac
tggggtctccgtgtccgtggtcagcacaccaagactactggcaggaggggaaagactgtc
ggtgtctccaagaagagataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107277000
Entry
107277000         CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S18-like
  KO
K02964  small subunit ribosomal protein S18e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    107277000
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    107277000
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    107277000
SSDB
Motif
Pfam: Ribosomal_S13
Other DBs
NCBI-GeneID: 107277000
NCBI-ProteinID: XP_015645873
LinkDB
Position
7:3898511..3899974
AA seq 137 aa
MPFLAIAEFCVGRIFYLGPGGVSVHRNNRHLPRTRGPRHDHDQRLADGLQDTLRTFLCLC
DHPPSSWFLNRKKDYKDGRFSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQH
TKTTGRRGKTVGVSKKR
NT seq 414 nt   +upstreamnt  +downstreamnt
atgccgttcctcgccatcgccgagttctgcgtcggccggatcttttacctgggaccggga
ggtgtttctgttcaccgtaacaatcggcatcttcctcgcactcgcggccctcgccatgat
catgaccaacggctggccgatggtctacaggacactcttcgcacctttctctgtctgtgt
gatcatcctcctagcagctggtttttgaacaggaagaaggactacaaggatgggaggttc
tctcaggttgtttctaacgctctggacatgaagctcagggatgaccttgagaggctgaag
aagatcaggaaccaccgtggtctccgtcactactggggtctccgtgtccgtggtcagcac
accaagactactggcaggaggggaaagactgtcggtgtctccaagaagagataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334407
Entry
4334407           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S18
  KO
K02964  small subunit ribosomal protein S18e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4334407
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4334407
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4334407
SSDB
Motif
Pfam: Ribosomal_S13 DUF2746 NFACT_N DUF6241 LuxT_C
Other DBs
NCBI-GeneID: 4334407
NCBI-ProteinID: XP_015630007
UniProt: Q7G7H9 Q8H590
LinkDB
Position
3:complement(33045728..33047468)
AA seq 152 aa
MSLIAGEDFQHILRLLNTNVDGKQKIMFALTSIKGVGRRFSNIACKKADIDMNKRAGELT
PEELERLMTVVANPRQFKVPDWFLNRKKDYKDGRFSQVVSNALDMKLRDDLERLKKIRNH
RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
NT seq 459 nt   +upstreamnt  +downstreamnt
atgtcgctgatcgccggggaggacttccagcacatcctgcgtctgctgaacaccaacgtc
gatgggaagcagaagatcatgttcgcgctcacctccatcaagggtgtcggccgcaggttc
tccaacatcgcctgcaagaaggccgacatcgacatgaacaagagggccggtgagcttacg
ccggaggagctggagcggctgatgaccgtggtggcgaacccgcggcagttcaaggtgccc
gactggttcctcaacaggaagaaggactacaaggacgggaggttctcccaggttgtctcc
aacgcgctcgacatgaagctcagggatgatcttgagaggctcaagaagatcaggaaccac
cgtggtctgaggcactactggggcctccgtgtgcgtgggcagcacaccaagacaaccgga
aggaggggtaagactgtcggtgtgtccaagaagcgataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342526
Entry
4342526           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S18
  KO
K02964  small subunit ribosomal protein S18e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4342526
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4342526
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4342526
SSDB
Motif
Pfam: Ribosomal_S13 DUF2746 NFACT_N DUF6241 LuxT_C
Other DBs
NCBI-GeneID: 4342526
NCBI-ProteinID: XP_015644795
UniProt: Q7G7H9 Q8H590
LinkDB
Position
7:3872105..3875053
AA seq 152 aa
MSLIAGEDFQHILRLLNTNVDGKQKIMFALTSIKGVGRRFSNIACKKADIDMNKRAGELT
PEELERLMTVVANPRQFKVPDWFLNRKKDYKDGRFSQVVSNALDMKLRDDLERLKKIRNH
RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR
NT seq 459 nt   +upstreamnt  +downstreamnt
atgtcgctgatcgcgggggaggatttccagcacatcctgcgtctgctgaacacgaacgtg
gatgggaagcagaagatcatgttcgcgctcacctccatcaagggtgtcggccgccgcttc
tccaacatcgcctgcaagaaggccgacatcgacatgaacaagcgggctggtgaactcact
cctgaggagcttgagcgcctcatgactgtggtggcaaaccctcgccagttcaaggtccct
gactggtttctgaacaggaagaaggactacaaggatgggaggttctcccaggttgtttct
aacgccctggacatgaagctcagggatgaccttgagaggctgaagaagatcaggaaccac
cgtggtctccgtcactactggggtctccgtgtccgcggtcagcacaccaagactactggc
aggaggggaaagactgtcggtgtctccaagaagagataa

DBGET integrated database retrieval system