KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276146
Entry
107276146         CDS       T01015                                 
Name
(RefSeq) 5-pentadecatrienyl resorcinol O-methyltransferase-like
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
SSDB
Motif
Pfam: Methyltransf_2 Dimerisation Methyltransf_25 Methyltransf_12 Dimerisation2 Methyltransf_11 Methyltransf_PK
Other DBs
NCBI-GeneID: 107276146
NCBI-ProteinID: XP_015645977
UniProt: A0A0P0X625
LinkDB
Position
7:16272986..16274737
AA seq 352 aa
MEKEQQAGHGKLPHEQLLLQASTELMNLSLGYARSMALGCAAKLGVADAIHRAGGRATLH
DLHAALSLHPTKLPFLRRVMRVLVASGVFAQVEEEEEEEDHYRLTPVSSLLVTAGDGRGR
SLLPLVLFQLSPLCVTPATSMAEWLRSGGEEETAFEMVHGVGLWGACSRAPDLGEHFNDA
MAADSRFIMDMAINGSGRQVFDKITSMVDVAGGTGAAARAVAAAFPHIKCTVLDLPHVID
SIPADHGDVVQFVAGDMMDFIPKADALLLKFVLHDWSDEDCIKILKRCKEAIIPSRAAGG
KIIILDVVVGSSSEAICQGTQQLFDLIISVTRKSGARYSRRQDSLNTRLAQC
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggagaaagagcagcaagccggccatggcaagctccctcacgagcagctgttgctgcaa
gccagcacggagctcatgaacctcagcctgggctacgccaggtccatggccctcgggtgc
gccgccaagctcggcgtcgccgacgctatccaccgcgccggcggccgcgccaccctccac
gacctgcacgccgcgctgtccctccacccgaccaagctccccttcctgcgccgcgtcatg
cgcgtgctggtcgcctcgggcgtcttcgcgcaggtcgaggaggaggaggaggaggaggat
cactaccgcctcacgcccgtgtcgtccctgctcgtcaccgccggcgacggcagaggcagg
agcctcctgccgctggtgctcttccagctctcgccgctatgcgtgacgccggcgacgagc
atggccgagtggctcaggagcggcggcgaggaggagacggcgttcgagatggtgcacggc
gtgggattgtggggcgcctgcagccgcgccccggatctcggtgagcacttcaacgacgcc
atggcggctgactcgcggtttatcatggacatggccatcaacggctcgggccgccaggtg
ttcgacaagatcacctcgatggtggatgtcgcgggtggcaccggcgcggcggccagggcg
gtggccgccgcgttcccgcatatcaagtgcaccgtgctggaccttcctcacgtgatcgat
tccatcccggctgatcatggcgatgttgttcagtttgttgcaggtgatatgatggatttc
atccccaaagcagatgccctcctgcttaagtttgtgctacatgattggagtgatgaggac
tgcataaagatactaaaacgatgcaaagaagcaattattccttctagagctgcaggagga
aagatcatcattttagatgttgtagttggatcttcttctgaagcaatatgccaaggaacc
caacaattgtttgatctgattatttcggttacgaggaagagtggtgcaagatattcaagg
aggcaggattcactaaatacaagattagcccagtgttag

DBGET integrated database retrieval system