KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276201
Entry
107276201         CDS       T01015                                 
Name
(RefSeq) alpha carbonic anhydrase 7-like
  KO
K01674  carbonic anhydrase [EC:4.2.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00910  Nitrogen metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    107276201
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     107276201
SSDB
Motif
Pfam: Carb_anhydrase
Other DBs
NCBI-GeneID: 107276201
NCBI-ProteinID: XP_015649521
UniProt: Q6YZ80
LinkDB
Position
8:20312574..20315062
AA seq 276 aa
MSSARRLLLLAGAAAAIALLLSATAPVAGAEDDGYSYIPGSPRGPQNWGSLKPEWATCSS
GKMQSPINLGLLDLTLAPGLGNLNYTYKNANASVVNRGHDIMVRFDGDAGSLKINGTAYQ
LRQMHWHTPSEHTIDGRRYDMELHMVHLNAQNQAAVIGILYTIGTTPDEFLQKMEPYIIA
ISNQEGKEKMVVGGADPNVAKGKDTVYYRYMGSFTTPPCTEGVIWTVVRKVHTVSLSQIT
LLKAAVLMGNENNARPLQDVNNREIDLFFPLPLINN
NT seq 831 nt   +upstreamnt  +downstreamnt
atgagttcagctcgccgcctcctcctcctcgccggcgccgctgccgccatcgcactcctg
ctctcggccactgccccggtggccggagccgaggacgacggctacagctacatccctggc
tcgcccagggggccgcagaactggggcagcctgaaaccggaatgggccacctgcagcagc
ggtaagatgcagtcgccaatcaacctcggcctcctcgacctcaccttggctcccggcctc
ggcaacctcaactacacctacaagaacgccaacgcctccgtcgtcaaccgtggccacgac
atcatggttaggtttgacggcgacgctggtagcctaaagataaatggcacggcgtaccag
ctccggcaaatgcactggcatacgccgtcggagcacaccatcgatggccggaggtatgac
atggagctacatatggtgcacctcaatgcccagaaccaggccgccgtcattggcatcctc
tacaccatcggcaccaccccggacgagtttctgcaaaagatggagccttatataattgcg
atatcaaaccaagaaggtaaagagaagatggtcgttggtggggcggatccaaatgtagcc
aagggaaaggataccgtgtactatcgctacatgggctcctttaccacaccaccttgcacg
gagggggtcatctggaccgttgtcaggaaggtgcacaccgtgtcactgtcccaaatcaca
cttctcaaggcagctgtgctcatgggtaatgagaacaacgcgagacccctccaggatgtg
aacaacagggagattgacctgttctttcctcttcctctgatcaataactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326583
Entry
4326583           CDS       T01015                                 
Name
(RefSeq) carbonic anhydrase, chloroplastic isoform X1
  KO
K01673  carbonic anhydrase [EC:4.2.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00910  Nitrogen metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    4326583
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     4326583
SSDB
Motif
Pfam: Pro_CA
Other DBs
NCBI-GeneID: 4326583
NCBI-ProteinID: XP_015617238
UniProt: Q7F2G3
LinkDB
Position
1:25692732..25705082
AA seq 272 aa
MSTAAAAAAAQSWCFATVTPRSRATVVASLASPSPSSSSSSSNSSNLPAPFRPRLIRNTP
VFAAPVAPAAMDAAVDRLKDGFAKFKTEFYDKKPELFEPLKAGQAPKYMVFSCADSRVCP
SVTMGLEPGEAFTVRNIANMVPAYCKIKHAGVGSAIEYAVCALKVELIVVIGHSRCGGIK
ALLSLKDGAPDSFHFVEDWVRTGFPAKKKVQTEHASLPFDDQCAILEKEAVNQSLENLKT
YPFVKEGIANGTLKLVGGHYDFVSGNLDLWEP
NT seq 819 nt   +upstreamnt  +downstreamnt
atgtcgaccgccgccgccgccgccgctgcccagagctggtgcttcgccactgtcaccccg
cgctcccgcgccacagtcgtcgccagcctcgcctccccatcaccgtcctcctcctcctcc
tcctccaacagcagcaacctcccggcccccttccgcccccgcctcatccgcaacaccccc
gtcttcgccgcccccgtcgcccccgccgcgatggacgccgccgtcgaccgcctcaaggat
gggttcgccaagttcaagaccgagttctatgacaagaagccggagctcttcgagccgctc
aaggccggccaggcacccaagtacatggtgttctcgtgcgccgactctcgcgtgtgcccg
tcggtgaccatgggcctggagcccggcgaggccttcaccgtccgcaacatcgccaacatg
gtcccagcttactgcaagatcaagcacgctggcgtcgggtcggccatcgagtacgccgtc
tgcgccctcaaggtcgaactcatcgtggtgattggccacagccgctgcggtggaatcaag
gccctcctctcactcaaggatggagcaccagactccttccacttcgtcgaggactgggtc
aggaccggtttccccgccaagaagaaggttcagaccgagcacgcctcgctgcctttcgat
gaccaatgcgccatcttggagaaggaggccgtgaaccaatccctggagaacctcaagacc
tacccgttcgtcaaggaggggatcgccaacggcaccctcaagctcgtcggcggccactac
gacttcgtctccggcaacttggacttatgggagccctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329556
Entry
4329556           CDS       T01015                                 
Name
(RefSeq) alpha carbonic anhydrase 1, chloroplastic
  KO
K01674  carbonic anhydrase [EC:4.2.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00910  Nitrogen metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    4329556
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     4329556
SSDB
Motif
Pfam: Carb_anhydrase
Other DBs
NCBI-GeneID: 4329556
NCBI-ProteinID: XP_015626216
UniProt: Q6EPY7 A0A0P0VJV4
LinkDB
Position
2:19635544..19638855
AA seq 266 aa
MGTAKKSAIFVALLCTHILVNHACDSDVVFGYSGSTGPEHWGSLSPNFTTCSKGTYQSPI
NILKDDAVYNPKLEPLEMDYTAANTTIVDNVFNIALRYNDTAGTVKVDGKKYKLRQLHWH
SPSEHTINGQRFAVELHMVHHSDDGNITVIAVLYRHGKPDPFLFQIKDKLAALYLEGCKA
EKGEPLPVGLVDMRELKKGADRYFRYVGSLTTPPCTENVIWNIFGEIREMTKEQAAALRA
PLHGSYRHNRRPTQPLNGRTVQLNYM
NT seq 801 nt   +upstreamnt  +downstreamnt
atggggactgctaagaaaagtgcaatctttgttgcactgctgtgcactcacattcttgtg
aaccatgcatgtgacagtgatgtggtatttgggtacagtgggagtactggtccagagcat
tgggggagcttaagtcctaatttcacaacgtgctcaaaagggacgtaccagtccccaatc
aacattttgaaagatgacgcagtttacaacccaaagttggagccccttgaaatggattat
actgctgcaaacactaccattgttgacaatgtcttcaatattgcgctacgttacaacgac
actgctgggactgtgaaggtggatgggaaaaagtataaactgaggcaattgcattggcac
tctccctcagagcacaccatcaatggccaaaggtttgcagtggagctccacatggttcac
cattctgatgatggcaacattactgtcattgcagtcctttatcgacatgggaaacctgat
ccatttctttttcagataaaggataagttggctgcattatacttagagggctgtaaagcg
gagaaaggcgaacctcttcctgttggactcgtggatatgagggaattgaagaaaggcgcg
gataggtatttcagatacgttggatccctcacgacacctccatgcaccgaaaatgttatc
tggaacatttttggagagataagagaaatgaccaaagagcaggctgctgctttgagggcc
cctttgcacgggagttacaggcacaaccgcaggccgacacagccactcaatggtcgcacc
gtgcagctcaattacatgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335782
Entry
4335782           CDS       T01015                                 
Name
(RefSeq) alpha carbonic anhydrase 1, chloroplastic
  KO
K01674  carbonic anhydrase [EC:4.2.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00910  Nitrogen metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    4335782
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     4335782
SSDB
Motif
Pfam: Carb_anhydrase
Other DBs
NCBI-GeneID: 4335782
NCBI-ProteinID: XP_015634314
UniProt: B7E3S3 A0A8J8YC30
LinkDB
Position
4:20387668..20390008
AA seq 278 aa
MAASHGNAIFVLLLCTLFLPSLACDSGGVKFGYTGSIGPDFWGNLSADFTRCSNGKQQSP
IDIDTNNLVHELNMEPLHRNYTAANATLVDNIFNVALRYEEAAGVLSINGVKYTLKQMHW
HSPSEHTINGFRFPLELHMVHTNENGNITVLAFLYRFGRPDPFFEQIQDKLAALNAEGCK
AEKGSPVPAGSVSLLTMRQHVHIYYRYVGSLTTPPCAENVIWNIPAMPREMTPQQAADLM
APLDEGYRRNSRPTQQMNGRTVQLYHRFWGKKKRRSSP
NT seq 837 nt   +upstreamnt  +downstreamnt
atggcagcttctcatggaaatgcgatctttgttctgctgctgtgcactctctttctcccg
tcccttgcatgtgacagcggtggcgtgaagtttgggtacactggttctatcggccctgac
ttctgggggaatttgagtgccgacttcacgcgttgctcgaacggaaagcagcagtcccca
attgacatcgacaccaacaacctggttcatgaactgaatatggagccactccatagaaat
tataccgctgcaaatgctactcttgtcgacaacatcttcaacgtcgcgctgcggtacgaa
gaggcagcaggggttctgagcattaacggggtgaagtacacgctgaagcagatgcactgg
cactctccttccgagcacaccatcaacggcttcaggttcccactggagctccacatggtt
cacaccaacgaaaatggcaacatcaccgttctggcctttctctaccgatttggcaggcca
gacccgttcttcgaacagattcaggataagctggctgcgctcaacgcggagggctgcaag
gcagagaaaggcagcccggtccctgccggatctgtgagcttgctgacgatgaggcagcac
gtgcacatatactacagatacgttgggtcactgaccacgccaccgtgcgccgagaacgtg
atctggaacatccctgccatgccgagagagatgacaccgcagcaggccgccgatctgatg
gctcccctggacgaaggctaccgccggaacagcaggccgacgcagcagatgaacggccgc
accgtgcagctctaccacaggttctgggggaagaagaagaggaggagctccccgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345604
Entry
4345604           CDS       T01015                                 
Name
(RefSeq) alpha carbonic anhydrase 7
  KO
K01674  carbonic anhydrase [EC:4.2.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00910  Nitrogen metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    4345604
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     4345604
SSDB
Motif
Pfam: Carb_anhydrase
Other DBs
NCBI-GeneID: 4345604
NCBI-ProteinID: XP_015649427
UniProt: Q6YZ83 Q8GTK1
LinkDB
Position
8:20283023..20285487
AA seq 276 aa
MSTSARRLLLLAGAAAAIALLLSATAPVAGAEDDGYSYIPGSPRGPQNWGSLKPEWATCS
SGKMQSPINLGLLDLTLAPGLGNLNYTYQNANASVVNRGHDIMVRFDGDAGSLKINGTAY
QLRQMHWHTPSEHTIDGRRYDMELHMVHLNAQNQAAVIGILYTIGTRDEFLQKLEPYIIE
ISKQEGKERVIIGGADPNVAKGQDTVYYRYMGSFTTPPCTEGVIWTVVRKVRTVSLSQIT
LLKAAVLTGNENNARPLQGVNNREIDLFLPLPLINN
NT seq 831 nt   +upstreamnt  +downstreamnt
atgagtacttcagctcgccgcctcctcctcctcgccggcgccgctgccgccatcgcactc
ctgctctcggccactgccccggtggccggagccgaggacgacggctacagctacatccct
ggctcacccagggggccgcagaactggggcagcctgaagccggaatgggccacctgcagc
agcggcaagatgcagtcgccgatcaacctcggcctcctcgacctcaccttggctcccggc
ctcggcaacctcaactacacctaccagaacgccaacgcctccgtcgtcaaccgtggccac
gacatcatggtcaggtttgacggcgacgccggtagcctaaagataaatggcacggcgtac
cagctccggcagatgcactggcacacgccgtcggagcacaccatcgatggccggaggtac
gacatggagctgcacatggtgcacctcaacgcccagaaccaggccgccgtcattggcatc
ctctacaccatcggcacccgggacgagtttctgcaaaagctagagccttatataattgag
atatcaaagcaagaaggcaaagagagagtgatcattggtggggcggatccaaatgtagcc
aagggacaggataccgtgtactaccgctacatgggctcctttaccacaccaccttgcact
gagggagtcatctggaccgttgtcaggaaggtgcgcaccgtgtcactgtcccaaatcaca
cttctcaaggcagctgtgctcacgggtaacgagaacaacgcgagaccccttcagggcgtg
aacaacagggagattgacctgttccttcctctccctctcatcaacaactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347247
Entry
4347247           CDS       T01015                                 
Name
(RefSeq) alpha carbonic anhydrase 7 isoform X1
  KO
K01674  carbonic anhydrase [EC:4.2.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00910  Nitrogen metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    4347247
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     4347247
SSDB
Motif
Pfam: Carb_anhydrase
Other DBs
NCBI-GeneID: 4347247
NCBI-ProteinID: XP_015610924
LinkDB
Position
9:complement(17074260..17079823)
AA seq 370 aa
MASIPKSLSLHDTASSPRNPRTMARARRGRQNAAASPPSLALQLQVASLVIVFVFAFSSA
ITPTRADHVEGHMSHEMFGYENDATGPAKWGSLHKEWAVCGDGKKQSPIDITTVEPQKVK
EPLMQAYKAGATTIQNRGHDYMLKWKDGNSKLTVQGKEYTLKQVHWHEPSEHTINGTRFD
AEMHMVHEDPSMARAVVSVLLSTKAGQPNAVLTEMAPHFKNLAGKEKAEEEVKEPVDPST
WVDKTSGYYRYDGSLTTPPCTEGVIWTIMSKIGDASKEQIDLLKTVATTVEPNARPAQKL
NDRIVRSKRYNKVVASTTAKPLQQTALQRLASEGRTELAPPGQRHKKTEHYAQHMFQVFI
RYLRTSRGSR
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggcgtctattccaaaatccctttccctccacgacaccgcttccagcccacgcaaccct
cgaacaatggcgagggctcgccggggacgacaaaacgccgccgcatcgccgccgtcgctg
gccctgcagctgcaggtggccagcctcgtcatcgtcttcgtcttcgccttctcctccgcc
atcacgcctacacgagctgatcatgtagaaggacacatgtcgcacgagatgtttggctac
gaaaacgacgcgacggggccggcgaagtggggctcgctgcacaaggagtgggccgtctgc
ggcgacggcaagaagcagtcgccgatcgacatcaccacggtggagccgcagaaagtgaag
gagccgctgatgcaagcctacaaggccggcgccaccaccattcagaaccgaggccacgac
tacatgctgaaatggaaagatgggaatagcaagctgacggtccaagggaaggagtacacg
ctcaagcaggtgcactggcatgaaccctccgagcacacaatcaacggaaccaggttcgac
gcagagatgcacatggttcacgaggaccccagcatggcgagagccgtcgtctctgtgctg
ttgagcaccaaagcaggccaacccaacgcagtgctcaccgagatggcgccacatttcaag
aaccttgctggtaaagagaaggccgaggaggaagtgaaggagcctgttgatccatcgacc
tgggtagataaaacctcaggctactacagatacgacggctccctcacaacaccgccttgc
actgaaggagtgatctggacgatcatgagcaagataggagatgcatcgaaggagcagatt
gacttgctcaagacagtggctacgactgtggaaccaaatgcacggccagctcagaaactc
aacgatcgaattgtgaggagcaaacggtacaacaaggttgttgcatctactactgccaaa
ccactacagcaaacagcactacagcgccttgcatcagaagggcgcacagagctagcgcca
ccaggacagcgccacaagaaaacagagcactacgcgcagcatatgttccaagtttttatc
aggtatcttaggacatcaagaggcagtagatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347305
Entry
4347305           CDS       T01015                                 
Name
(RefSeq) beta carbonic anhydrase 5, chloroplastic isoform X1
  KO
K01673  carbonic anhydrase [EC:4.2.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00910  Nitrogen metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    4347305
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     4347305
SSDB
Motif
Pfam: Pro_CA CXXC_Zn-b_euk
Other DBs
NCBI-GeneID: 4347305
NCBI-ProteinID: XP_015612363
LinkDB
Position
9:complement(17567657..17572387)
AA seq 333 aa
MVTWPLRSAARRLAAAAAAARAAPASVAHSPPPAPMPPQPCPPEDAALQHLRRATGHDDG
VPAAGEQPPSRRPIHRRDFPCTTMASRDHSGLTRQLLDFQHGTVDEIDGEHDPFMELKAR
FMDFKHRNCVDNISNYQNLAQQQTPKFMVVACADSRVCPSSVLGFQPGEAFTVRNIANLV
PPYQHGASETSAALEFAVNTLEVENVLVVGHSRCGGIQALMSMKSKQDDSQSRSFIRDWV
SIAKSARLSTEAAAGNLNFELQCKHCEKESINSSLLNLLTYPWIEKRVNEGTLSLHGGYY
NFIDCTFEKWKLVYRQGLEGGSKYAIKNRTTWS
NT seq 1002 nt   +upstreamnt  +downstreamnt
atggtcacctggcccttgcgatcagcagctcggcgcttggctgctgccgccgccgccgca
cgcgcagctccagcttcggtcgctcactcgccaccacctgcgccgatgcctcctcagcca
tgtccacctgaagacgcagcgctccagcacttgcggcgcgccaccggacacgacgacggc
gtccctgccgccggcgagcagccgccgtctcgtcgtccaatccatcggagggactttccg
tgtaccacaatggcctcaagagatcattctggtttgactcgacagcttttagattttcaa
catggtacagtagatgagatagatggggaacatgatccattcatggagttgaaagcaagg
ttcatggacttcaagcacaggaattgtgtggataatatttctaactatcaaaatcttgct
cagcagcaaacaccaaagttcatggtggttgcttgtgctgattctagggtatgtccttca
agtgttttggggtttcagcccggggaagcatttactgtccgtaatatagcaaatttggta
ccaccatatcagcatggtgcttcagagactagcgctgcactggagttcgctgtcaacaca
ctagaggtagagaatgtattagtggtaggtcacagccgttgtggtggtatccaagcacta
atgagtatgaaaagtaagcaagatgattcgcaatctagaagctttatcagagattgggtg
tcaattgcaaagagtgcaaggttaagtacggaagcagcagctggaaatttgaattttgaa
ttacagtgcaaacattgtgaaaaggaatcaattaatagctcactgttgaacttgttaaca
tacccttggatagagaaaagggtgaatgaaggaactttgagccttcatgggggctattac
aattttattgattgcacattcgagaagtggaaattagtataccgccaagggttggaaggt
ggaagcaagtatgccataaagaataggactacctggtcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349804
Entry
4349804           CDS       T01015                                 
Name
(RefSeq) alpha carbonic anhydrase 7
  KO
K01674  carbonic anhydrase [EC:4.2.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00910  Nitrogen metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    4349804
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     4349804
SSDB
Motif
Pfam: Carb_anhydrase
Other DBs
NCBI-GeneID: 4349804
NCBI-ProteinID: XP_015616689
LinkDB
Position
11:2488095..2490271
AA seq 287 aa
MVSSHAAIVFFLVAASSLLSYGEAAPKMTAVAADYGYPADYGYAAGSKLGPENWGKLSPA
YKLCGDGKKQSPIDIVTKQAISNPNLDSLNRTYTASDGTLVNNGKDILMEFEPDKVGTVT
VNGKVYSFRRVHWHAPSEHTINGEKHPLELQMVHAAADGSLAVIAILYKYGAPDSFYFQL
KRKLAELAADGCSFGEENAQVALGLVHLRSLQKRTGSYFRYAGSLTAPPCTEDVFWSVLG
KIRQISQEQVALITALLPAGGARPTQPLNGRTVQFYNPPNSTISFKV
NT seq 864 nt   +upstreamnt  +downstreamnt
atggtgtcctcccatgcagccatcgtcttcttcctcgtcgccgcgtcgtcgctcctctca
tacggtgaggcggcgccgaagatgacggcggtggcggcggactacgggtacccggcggac
tacgggtacgcggcggggagcaagctggggccggagaactgggggaagctgagcccggcg
tacaagctgtgcggcgacggcaagaagcagtcgcccatcgacatcgtcaccaagcaggcc
atctccaaccccaacctcgactcactcaaccgcacctacaccgcctccgacggcaccctc
gtcaacaacggcaaggacatcttgatggagttcgagccagacaaggtggggacggtgacg
gtgaacggcaaggtgtacagcttcaggcgggtgcactggcacgcgccgtcggagcacacc
atcaacggggagaagcacccgctggagctccagatggtgcacgctgccgccgacggcagc
ctcgccgtcatcgccatcctctacaagtacggcgccccggactccttctacttccagctc
aagaggaagctcgccgagctcgccgccgacggctgcagcttcggcgaggagaacgcccag
gtcgccctcggcctcgtccacctccgctcgctgcagaagcggacggggagctacttccgc
tacgccggctcgctgacggcgccgccgtgcaccgaggacgtcttctggagcgtgctcggc
aagatcaggcagatcagccaggagcaggtcgccctcatcaccgcgctgctccccgccggc
ggcgcgaggccgacgcagccgctcaacggccgcaccgtgcagttctacaacccgcccaac
agcaccatctccttcaaggtctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351529
Entry
4351529           CDS       T01015                                 
Name
(RefSeq) alpha carbonic anhydrase 7
  KO
K01674  carbonic anhydrase [EC:4.2.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00910  Nitrogen metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    4351529
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     4351529
SSDB
Motif
Pfam: Carb_anhydrase
Other DBs
NCBI-GeneID: 4351529
NCBI-ProteinID: XP_015619564
UniProt: Q2QXK5 A3CF16
LinkDB
Position
12:2643967..2645267
AA seq 281 aa
MVSLRAAIVLVVAASSVAVAFSHAEGNEGPDFTYIEGAMDGPSNWGKLSPEYRMCGEGRS
QSPIDINTKTVVPRSDLDTLDRNYNAVNATIVNNGKDITMKFHGEVGQVIIAGKPYRFQA
IHWHAPSEHTINGRRFPLELHLVHKSDADGGLAVISVLYKLGAPDSFYLQFKDHLAELGA
DECDFSKEEAHVAAGLVQMRSLQKRTGSYFRYGGSLTTPPCGENVVWSVLGKVREISQEQ
LHLLMSPLPTKDARPAQPLNGRAVFYYNPPGSAVSFQEFAK
NT seq 846 nt   +upstreamnt  +downstreamnt
atggtgtctctccgcgcggccatcgtcctcgtcgtcgccgcctcgtcggtcgccgtcgcc
ttctctcatgcggaagggaacgaggggccggacttcacctacatcgaaggcgccatggac
gggccgtcgaactgggggaagctgagcccggagtacaggatgtgcggcgaggggaggtcg
cagtcgccgatcgacatcaacaccaagaccgtcgtcccgcgctcggacctcgacacgctg
gaccgcaactacaacgccgtgaacgccaccatcgtcaacaacggcaaggacatcaccatg
aagttccacggcgaggtcggccaggtgatcatcgccgggaagccgtacaggttccaggcg
atccactggcacgcgccgtcggagcacaccatcaacggcaggcgcttcccgctcgagctc
cacctcgtccacaagtccgacgccgacggcggcctcgccgtcatctccgtcctctacaag
ctcggcgccccggactccttctacctccagttcaaggaccacctcgccgagctcggcgcc
gacgagtgcgacttcagcaaggaggaggcccacgtcgccgccgggctggtgcagatgagg
tcgctgcagaagcgcacggggagctacttccggtacggcggctcgctgacgacgccgccg
tgcggcgagaacgtggtgtggagcgtgctcgggaaggtgagggagatcagccaggagcag
ctgcacctgctcatgtcgccattgccgaccaaggacgccaggccggcgcagccgctcaat
ggcagggccgtcttctactacaacccgccgggcagcgccgtctccttccaggaattcgcc
aagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9267362
Entry
9267362           CDS       T01015                                 
Name
(RefSeq) alpha carbonic anhydrase 7
  KO
K01674  carbonic anhydrase [EC:4.2.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00910  Nitrogen metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    9267362
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     9267362
SSDB
Motif
Pfam: Carb_anhydrase
Other DBs
NCBI-GeneID: 9267362
NCBI-ProteinID: XP_015649533
UniProt: Q6YZ76
LinkDB
Position
8:20350916..20353848
AA seq 277 aa
MHRARLLVVVVTAVVTLLLLAPAAGAEEDDQFGYIPGTPRGPENWGSLKPEWATCSSGEM
QSPINLGLLDLTLAPGLGDLNYTYRNANATVVNRGHDIMVRFDGGDDAAAAGGLVINGTA
YRLRQVHWHAPSEHAVDGRRYDMELHMVHLNTQNQTAVVGILYAIGAQDEFLHKLEPYII
EVADQKDKEKIVNGGVDPNVAKEHDIVYYRYMGSLTTPPCTEGVIWTIVRKVHTVSLSQL
ALLKAAVVNGNEKNARPLQDVNNRNIGLFIPLPLINV
NT seq 834 nt   +upstreamnt  +downstreamnt
atgcatcgcgcacgcctcctcgtcgtcgtcgtcaccgccgtcgtcaccctcctgctcctg
gcgccggccgccggagccgaggaagacgatcagttcggctacatccccggcacaccgagg
gggccggagaactggggcagcctgaagccggaatgggccacctgcagcagcggcgagatg
cagtcgccgatcaacctcggcctcctcgacctcaccctggcccccggcctcggcgacctc
aactacacctaccgaaacgccaacgccaccgtcgtcaaccgtggccacgacatcatggtc
aggttcgacggcggcgatgacgccgccgccgccggcgggctggtgattaacggcacggcg
taccggctccggcaggtgcactggcacgcgccgtcggagcacgccgtcgatggccggagg
tacgacatggagctgcacatggtgcatctcaacacccagaaccagaccgccgtcgtcggc
atcctctacgccatcggcgcccaggatgagttcctgcacaagttggagccatatattatt
gaagttgcagaccaaaaagataaggagaagattgtcaatggtggggtggatccaaacgtg
gccaaagagcatgatatcgtgtattaccgctacatgggctccttaaccacaccaccttgc
accgagggagttatctggaccattgtcaggaaggtgcatactgtgtcgctgtctcagctt
gcacttctcaaggcagctgtggttaatggtaatgagaagaatgcgaggcccctccaggac
gtgaacaataggaacatcggcttgttcattcctctccctctgatcaacgtataa

DBGET integrated database retrieval system