KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276318
Entry
107276318         CDS       T01015                                 
Name
(RefSeq) calcium-dependent protein kinase 2-like
  KO
K13412  calcium-dependent protein kinase [EC:2.7.11.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    107276318
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:osa01001]
    107276318
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107276318
Protein kinases [BR:osa01001]
 Serine/threonine kinases: CAMK group
  CDPK family
   107276318
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH Kinase-like Pkinase_fungal ABC1 Gam Choline_kinase
Other DBs
NCBI-GeneID: 107276318
NCBI-ProteinID: XP_015619251
LinkDB
Position
12:18171759..18179705
AA seq 422 aa
MGNVCVGTTCSLSKNGLLCAIWRNGSTTTSSTPSHPTISRSVPVVQPSSPSSPTSEPPPP
QQQLTSTAPPRPIVISEPVRKPTQPHPRPKQPTKPPPSSSTQPQQRHQSQVKKHISSAGL
QVESVLQQKAENLKDRYNLGRKLGQGLFGTTYLCVDKATRKEYACKSIAKQKLVIDDDVE
FIRREIRIMHHLAGHPNIISIRGSYEDAMAVHIVMELCTGGELFDRIISKGYYTERQAAE
VARIIVSVIESCHSLGVMHRDLKPENFLFVSNEEDAPLKLIDFGLSIFFRQGETFTDVVG
SMYYVAPEVLRGNYGQQADVWSAGVIIYILLCGVPPFWADTKQGVFDKVLHGMLEFDADP
WTNVSEGAKDLLRKVLVRDPKERLTAHQVLRHPWLEMCSNGTGKTTELNVEHLYEREEMY
YK
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgggcaacgtctgtgttggcacaacctgtagtttgtcgaagaacggccttctttgcgcc
atctggcgaaatggatcaaccaccacttcctccaccccatcccaccccaccatctcgcgc
tctgtccccgtcgtccagccctcttccccctcttcaccgacctccgagccgccaccgcca
cagcagcagctcacctctactgcccctccaagaccaattgttatctctgagccagtgaga
aagccaactcaaccacatcccaggccgaaacaaccgaccaaaccgccgccgtcatcgagc
acccagccacagcagaggcatcagtctcaggtcaagaagcacatctccagcgccgggttg
caggtggagtcagtgctccaacaaaaggcggagaatctcaaggataggtacaaccttggg
cgcaagcttgggcagggcctgtttggcacaacatacttgtgcgtggacaaggcaaccaga
aaggagtatgcgtgcaagtcgatcgcaaagcagaagctcgtcattgatgacgacgtggag
ttcatccgccgcgagatcaggatcatgcaccaccttgctggccatccaaacatcatctcc
atccggggcagctacgaggatgccatggcggtgcacattgttatggagctctgcactggc
ggtgagctattcgaccgcatcatcagcaagggatattacacagagaggcaggctgctgag
gttgcccgcatcatcgtctctgtcatcgagtcttgccactctctcggtgtcatgcatcgc
gacctcaagcccgagaacttcctcttcgttagcaacgaggaggatgcgccactcaaactc
attgactttggcctctccatattcttccgccaaggcgagacgttcactgacgtggttggg
agcatgtattacgtggcaccagaggtgttgagagggaattatgggcagcaagctgatgtg
tggagcgctggcgtcatcatctacatcctcctttgtggcgtaccaccattctgggctgat
acaaagcagggggtatttgacaaggtgctgcatggcatgctagaatttgacgcggatccg
tggacaaatgtgtcggaaggtgccaaggacctgcttcggaaggtccttgtccgggatcct
aaggagcggctcacagcgcaccaagtactacgccatccatggttggagatgtgcagcaat
ggcactggaaaaacaactgaactcaacgttgaacacttgtacgagagggaagagatgtac
tacaaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326638
Entry
4326638           CDS       T01015                                 
Name
(RefSeq) calcium-dependent protein kinase 3
  KO
K13412  calcium-dependent protein kinase [EC:2.7.11.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4326638
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:osa01001]
    4326638
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     4326638
Protein kinases [BR:osa01001]
 Serine/threonine kinases: CAMK group
  CDPK family
   4326638
SSDB
Motif
Pfam: Pkinase EF-hand_1 EF-hand_7 PK_Tyr_Ser-Thr EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_4 EF-hand_9 SPARC_Ca_bdg Kinase-like Kdo Caleosin APH Imm51
Other DBs
NCBI-GeneID: 4326638
NCBI-ProteinID: XP_015650814
UniProt: A2ZVI7
LinkDB
Position
1:24839046..24843482
AA seq 518 aa
MGNRTSRHHRAAPEQPPPQPKPKPQPQQQQQQWPRPQQPTPPPAAAPDAAMGRVLGRPME
DVRATYTFGRELGRGQFGVTYLVTHKATGKRFACKSIATRKLAHRDDIEDVRREVQIMHH
LTGHRNIVELRGAYEDRHSVNLIMELCEGGELFDRIIARGHYSERAAAALCREIVAVVHS
CHSMGVFHRDLKPENFLFLSKSEDSPLKATDFGLSVFFKPGEHFKDLVGSAYYVAPEVLK
RNYGAEADIWSAGVILYILLSGVPPFWAESEDGIFDAVLRGHIDFSSEPWPSISNGAKDL
VKKMLRQDPKERLTSAEILNHPWIREDGEAPDKPLDITVISRMKQFRAMNKLKKVALKVV
AENLSDEEITGLKEMFRSLDTDNSGTITLEELRSGLPKLGTKISESEIRQLMEAADVDGN
GTIDYAEFISATMHMNRLEKEDHILKAFEYFDKDHSGYITVDELEEALKKYDMGDDKTIK
EIIAEVDTDHDGRINYQEFVAMMRNNNPEIAPNRRRMF
NT seq 1557 nt   +upstreamnt  +downstreamnt
atgggcaaccgcacgtcgcgccaccaccgcgccgctcccgagcagccgccgccccagccc
aagccgaagcctcagccgcagcagcagcagcagcagtggccgaggccgcagcagccgacc
ccgccgccggcggcggcgccggacgcggcgatggggagggtgctggggcggccgatggag
gacgtccgcgcgacctacaccttcgggcgcgagctcgggcggggccagttcggggtcacc
tacctcgtcacccacaaggccacggggaagcgcttcgcctgcaagtccatcgccacgcgg
aagctcgcccaccgcgacgacatcgaggacgtgcgccgggaggtgcagatcatgcaccac
ctcacgggccaccgcaacatcgtcgagctccggggcgcctacgaggaccgccactcggtc
aacctcatcatggagctctgcgagggcggggagctcttcgaccgcatcatcgccaggggg
cactactccgagcgcgccgccgccgcgctctgccgcgagatcgtcgccgtcgtgcacagc
tgccactccatgggggtcttccaccgggatctcaagccggagaactttttgttcctcagt
aaaagcgaggactcgccgctcaaggccactgacttcggtctttccgttttcttcaagcct
ggggagcattttaaggaccttgttggaagtgcgtattatgttgcacctgaggtgctgaaa
cgaaactatggagcagaggctgacatatggagtgctggcgttattctttacatccttctt
tctggtgttccacctttttgggcagagagtgaagatggtatatttgatgccgtattacgt
ggtcacattgatttctcgtctgaaccttggccttcgatatccaatggtgcaaaagatttg
gttaagaagatgttgcggcaagacccaaaagagcgccttacttctgctgaaattttgaac
cacccatggattagagaggatggagaagccccagacaagccacttgacattacagttatc
agcaggatgaagcagttcagggcaatgaacaagcttaagaaagttgcattgaaggttgtt
gcagagaacttgtcagatgaagagattacaggcttaaaagaaatgttcagatccttggat
actgataacagtgggacaataactcttgaggagctaagatctggtttaccaaaacttggc
accaaaatttctgaatcagaaattagacagctgatggaggcggctgatgttgatggaaat
ggaaccattgactatgctgagttcatatcagcgacaatgcacatgaacagattggagaag
gaagaccacatacttaaagcatttgagtattttgataaggaccacagcggatacataaca
gtagatgagttggaagaagctctgaagaagtatgatatgggggacgataaaacgattaag
gaaatcatcgctgaagtagatactgatcatgatggaagaattaactaccaggagtttgtc
gccatgatgaggaacaacaaccctgagattgctcccaaccggcggcgcatgttctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327438
Entry
4327438           CDS       T01015                                 
Name
(RefSeq) calcium-dependent protein kinase 13
  KO
K13412  calcium-dependent protein kinase [EC:2.7.11.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4327438
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:osa01001]
    4327438
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     4327438
Protein kinases [BR:osa01001]
 Serine/threonine kinases: CAMK group
  CDPK family
   4327438
SSDB
Motif
Pfam: Pkinase EF-hand_1 PK_Tyr_Ser-Thr EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 SPARC_Ca_bdg Kinase-like Kdo APH EF-hand_4 EF-hand_9 GAD Pkinase_fungal RIO1
Other DBs
NCBI-GeneID: 4327438
NCBI-ProteinID: XP_015622474
UniProt: Q8LPZ7
LinkDB
Position
1:35619684..35625780
AA seq 551 aa
MGNCCRSPAAAAREDVKSSHFPASAGKKKPHQARNGGVGGGGGGGGGGGGGGGAGQKRLP
VLGEEGCELIGGIDDKYALDRELGRGEFGVTYLCMDRDTKELLACKSISKRKLRTAVDVE
DVRREVAIMRHLPKSASIVSLREACEDEGAVHLVMELCEGGELFDRIVARGHYTERAAAN
VTRTIVEVVQLCHRHGVIHRDLKPENFLFANKKENSPLKAIDFGLSIFFKPGEKFSEIVG
SPYYMAPEVLKRNYGPEIDIWSAGVILYILLCGVPPFWAETEQGVAQAILRGNIDFKREP
WPNVSENAKDLVRRMLEPDPKLRLTAKQVLEHPWLQNAKKAPNVPLGDIVKSRLKQFSRM
NRFKRRALRVIADHLSAEEVEDIKEMFKAMDTDNDGIVSYEELKSGIAKFGSHLAESEVQ
MLIEAVDTNGKDALDYGEFLAVSLHLQRMANDEHLRRAFLFFDKDGNGYIEPEELREALV
DDGAGDSMEVVNDILQEVDTDKDGKISYDEFVAMMKTGTDWRKASRHYSRGRFNSLSMKL
IKDGSVKLVNE
NT seq 1656 nt   +upstreamnt  +downstreamnt
atggggaactgctgccgctcgccggccgccgcggcgcgggaggacgtcaagtcgtctcac
ttccccgcatcggccgggaagaagaagccccaccaggcgcggaacggcggcgtgggggga
ggcggcggcgggggcggcggcggcggaggaggaggaggagcggggcagaagcggctcccc
gtgctcggggaggaagggtgcgagctgatcggagggatcgacgacaagtacgcgctggac
cgggagctcgggcggggggagttcggggtgacgtacctgtgcatggatcgggacaccaag
gagctgctcgcctgcaagtccatctccaagcggaagctgaggacggcggtcgacgtggag
gacgtgcgccgggaggtcgccatcatgcgccacctccccaagagcgccagcatcgtgtcg
ctgcgggaggcgtgcgaggacgagggcgccgtgcacctcgtcatggagctctgcgaaggc
ggggagctcttcgaccgcatcgtcgcgcggggccactacacggagcgcgccgccgccaat
gtcacccgcaccatcgtggaggtcgtccagctctgccaccgccacggcgttatccaccgg
gacctcaagcccgagaacttcctcttcgccaacaagaaggagaactcgccgctcaaggcc
atcgatttcggcctctccatcttcttcaagcccggtgagaagttttctgaaattgtggga
agcccatattacatggctccagaggtattgaagagaaactatggtccggaaatagatatt
tggagtgcaggagttatcttgtatattttgttatgtggagttcctccattttgggctgag
actgagcaaggggtggcacaagccattcttcgtggaaatatcgatttcaaacgcgaaccc
tggccaaatgtttcagaaaatgctaaagatttggttcgacgcatgttggagcctgatcca
aaactcaggttaactgcaaagcaagttcttgaacatccatggcttcaaaatgctaagaaa
gctccaaatgttcctcttggagatattgtgaagtcaaggctcaaacaattttctagaatg
aatagattcaaaagaagagcactaagggtcattgccgatcatttatctgctgaggaagtt
gaggacataaaggagatgttcaaggctatggacactgataacgatggcattgtatcttat
gaagaattaaagagcgggatagcaaaatttggttctcatctggcagaatcggaagtgcag
atgcttatcgaagctgtggatacaaatggtaaggatgctctagattatggtgaatttttg
gctgtctctcttcatttgcaaaggatggcaaatgatgagcacctccggcgagccttccta
ttttttgacaaggatggcaatggctacatagagcctgaagagcttcgagaggctctagtg
gacgatggagcaggtgacagcatggaagtggtgaacgacatattgcaagaagttgacact
gataaggatggcaagattagctatgacgaatttgtagcaatgatgaagacgggcacagat
tggagaaaggcgtcccggcattactctagaggaagattcaacagccttagcatgaagctt
ataaaggatgggtccgtaaaactggtcaatgagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327560
Entry
4327560           CDS       T01015                                 
Name
(RefSeq) calcium-dependent protein kinase 34
  KO
K13412  calcium-dependent protein kinase [EC:2.7.11.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4327560
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:osa01001]
    4327560
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     4327560
Protein kinases [BR:osa01001]
 Serine/threonine kinases: CAMK group
  CDPK family
   4327560
SSDB
Motif
Pfam: Pkinase EF-hand_1 EF-hand_7 PK_Tyr_Ser-Thr EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_9 EF-hand_4 Kinase-like SPARC_Ca_bdg Kdo EFhand_Ca_insen tRNA_synt_1c_R1 HEPN_LA2681
Other DBs
NCBI-GeneID: 4327560
NCBI-ProteinID: XP_015632341
UniProt: Q5VQQ5
LinkDB
Position
1:34325301..34328118
AA seq 515 aa
MGNCCPGSGDAEPASSDASTGNGSSSFKAGASPSSAPAQNKPPAPIGPVLGRPMEDVRSI
YTIGKELGRGQFGVTSLCTHKATGQKFACKTIAKRKLSTKEDVEDVRREVQIMYHLAGQP
NVVELKGAYEDKQSVHLVMELCAGGELFDRIIAKGHYTERAAASLLRTIVEIIHTCHSLG
VIHRDLKPENFLLLSKDEDAPLKATDFGLSVFFKQGEVFKDIVGSAYYIAPEVLKRSYGP
EADIWSVGVILYILLCGVPPFWAESEHGIFNSILRGQVDFTSDPWPRISASAKDLVRKML
NSDPKKRISAYEVLNHPWIKEDGEAPDTPLDNAVMNRLKQFRAMNQFKKAALRVIAGCLS
EEEIRGLKEMFKSMDSDNSGTITVDELRKGLSKQGTKLTEAEVQQLMEAADADGNGTIDY
DEFITATMHMNRMDREEHLYTAFQYFDKDNSGCISKEELEQALREKGLLDGRDIKDIISE
VDADNDGRIDYSEFAAMMRKGNPEANPKKRRDVVI
NT seq 1548 nt   +upstreamnt  +downstreamnt
atgggcaactgctgtcctggctctggggatgcggagcccgcctcctccgacgcctccacc
ggcaacggctcgtcctccttcaaggccggcgcgtcgccgtcgtcggcgcccgcgcagaac
aagccgccggcgcccatcgggcccgtgctcggccgccccatggaggacgtccggagcatc
tacaccatcggcaaggagctcgggcgcgggcagttcggcgtcacctccctgtgcacccac
aaggcgacggggcagaagttcgcgtgcaagaccatcgccaagcggaagctgtccaccaag
gaggacgtggaggacgtgcggcgggaggtgcagatcatgtaccacctcgccgggcagccc
aacgtggtggagctcaagggcgcctacgaggacaagcagtccgtccacctcgtcatggag
ctctgcgccggcggcgagctcttcgaccggatcatcgccaagggccactacaccgagcgc
gccgccgcctcgctcctccgcaccatcgtcgagatcatccacacctgccactccctcggc
gtcatccaccgcgacctcaagcccgagaacttcctcctcctcagcaaggacgaggacgcc
cctctcaaggccaccgacttcggcctctccgtcttcttcaagcaaggagaggtgttcaag
gacatcgtcggcagcgcgtactacatcgcgccggaggtgctgaagcggagctacggcccc
gaggcggacatctggagcgtcggcgtcatcctctacatcctcctctgcggtgttcctcca
ttctgggctgaatcggagcatggcatcttcaattccatcctgagagggcaggtggacttc
accagtgacccatggccacgcatttcagctagcgccaaggaccttgtcaggaagatgctc
aactccgaccccaagaagagaatttcagcctacgaagtcctcaatcacccgtggatcaag
gaagatggagaagcacctgacacgccgcttgacaacgctgtcatgaacaggctcaagcag
ttcagggctatgaaccaattcaagaaagcagcgctaagggtcattgctggatgcttgtcg
gaggaagagatcagagggctgaaggagatgttcaagagcatggactctgacaacagcggc
accattaccgtcgatgagctgcgcaaagggctgtccaagcaagggaccaagctcacggag
gccgaagtgcagcagctaatggaggctgccgacgcggacgggaacggaaccatcgattac
gacgagttcatcacagcgacgatgcacatgaacaggatggacagagaggagcatctttac
accgcgtttcagtatttcgacaaggacaacagcggctgcatttcgaaggaggagctcgag
caagcgctgagggagaaaggtcttctcgatggcagagacatcaaagacatcatatcagaa
gtcgacgccgataacgatggaaggatagactacagcgagttcgcggcgatgatgcggaag
ggaaacccggaggccaatcccaagaagcgacgggacgttgtgatatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328155
Entry
4328155           CDS       T01015                                 
Name
(RefSeq) calcium-dependent protein kinase 16 isoform X1
  KO
K13412  calcium-dependent protein kinase [EC:2.7.11.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4328155
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:osa01001]
    4328155
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     4328155
Protein kinases [BR:osa01001]
 Serine/threonine kinases: CAMK group
  CDPK family
   4328155
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr EF-hand_1 EF-hand_5 EF-hand_7 EF-hand_6 EF-hand_8 Kinase-like SPARC_Ca_bdg Kdo ABC1 Dockerin_1
Other DBs
NCBI-GeneID: 4328155
NCBI-ProteinID: XP_015625883
UniProt: Q6Z2M9
LinkDB
Position
2:1387872..1394392
AA seq 522 aa
MGACFSSHTATAAADGGSGKRQQRKGDHKGKLPDGGGGEKEKEAARVEFGYERDFEGRYQ
VGRLLGHGQFGYTFAATDRASGDRVAVKRIDKAKMVRPVAVEDVKREVKILKELKGHENI
VHFYNAFEDDSYVYIVMELCEGGELLDRILAKKNSRYSEKDAAVVVRQMLKVAAECHLHG
LVHRDMKPENFLFKSTKEDSPLKATDFGLSDFIKPGKKFHDIVGSAYYVAPEVLKRRSGP
ESDVWSIGVITYILLCGRRPFWNKTEDGIFREVLRNKPDFRKKPWPGISSGAKDFVKKLL
VKNPRARLTAAQALSHPWVREGGEASEIPVDISVLSNMRQFVKYSRFKQFALRALASTLK
EEELADLKDQFDAIDVDKSGSISIEEMRHALAKDLPWRLKGPRVLEIIQAIDSNTDGLVD
FEEFVAATLHIHQMAELDSERWGLRCQAAFSKFDLDGDGYITPDELRMVQHTGLKGSIEP
LLEEADIDKDGRISLSEFRKLLRTASMSNLPSPRGPPNPQPL
NT seq 1569 nt   +upstreamnt  +downstreamnt
atgggcgcgtgcttctcatcccacactgcgaccgccgccgccgatggcgggagcgggaag
cggcagcagcggaagggggatcacaaggggaagctccccgatggcggcggcggcgagaag
gagaaggaggcggcgcgggtggagttcgggtacgagagggacttcgaggggaggtaccag
gtcgggaggctgctcggccacggccagttcggctacaccttcgccgccaccgaccgggcc
tccggtgaccgcgtcgccgtcaagcgcatcgacaaggccaagatggttcgccctgttgct
gtggaggatgtaaagagagaagtgaagattcttaaagaacttaaaggccatgagaatatt
gttcacttctacaatgcgtttgaagatgactcatatgtatatattgtgatggaactatgt
gagggtggtgaactattggaccggattttggcaaaaaagaacagccgttatagtgagaaa
gatgctgcagtggtggtgcggcagatgctcaaagtggcagctgagtgccatctgcatggg
ctagttcaccgagatatgaagcccgagaacttccttttcaaatcaaccaaggaggactca
cctttaaaggcaacagattttggtctgtcagacttcataaaaccagggaaaaagtttcac
gatatagttggcagtgcctattatgtagcaccagaagttttaaaacgacggtctggccct
gagtcagatgtttggagcataggagtcataacttatattttgctctgtgggagacgccct
ttttggaataagacagaggatggcatattcagagaggtactaagaaacaagcctgatttt
cgtaagaagccttggccaggcatcagttcaggtgctaaagatttcgttaaaaagttactt
gtaaagaacccaagggcaagattaaccgctgctcaagctctctcgcatccatgggtaaga
gaaggaggagaagcatctgagatccctgttgatatatctgtattgtccaacatgcgtcag
tttgtcaagtacagccgttttaagcaatttgctctgagggctttagcaagtacactaaaa
gaggaagaactagcagatctgaaggaccagttcgatgcaattgatgttgataaaagtgga
tcaattagtattgaggaaatgcggcatgcccttgcaaaggatcttccttggagattgaag
ggcccccgtgttctcgagattatccaagcaatcgacagcaacactgatggtcttgtggac
tttgaagagtttgtagcagcaaccctccatatacatcaaatggctgagcttgactctgaa
aggtggggcctacgctgccaggctgctttcagcaaatttgatctggatggtgacggatac
atcactccagatgaactcagaatggtgcagcacactggcttgaagggttccatcgagcca
ttgctggaggaggccgacatcgacaaagacgggagaataagcttgtcggagttccgcaag
ctcctgcggacagcgagcatgagcaaccttcccagtccaagaggacctccaaatccacaa
cccctgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330351
Entry
4330351           CDS       T01015                                 
Name
(RefSeq) calcium-dependent protein kinase 26
  KO
K13412  calcium-dependent protein kinase [EC:2.7.11.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4330351
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:osa01001]
    4330351
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     4330351
Protein kinases [BR:osa01001]
 Serine/threonine kinases: CAMK group
  CDPK family
   4330351
SSDB
Motif
Pfam: Pkinase EF-hand_1 EF-hand_7 PK_Tyr_Ser-Thr EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_4 EF-hand_9 Kdo APH SAP DUF374 Kinase-like tRNA_synt_1c_R1
Other DBs
NCBI-GeneID: 4330351
NCBI-ProteinID: XP_015625261
UniProt: Q0DYK7
LinkDB
Position
2:28086490..28092150
AA seq 549 aa
MGNTCGVTLRSKYFASFRGASQRHDEAGYAPVATSAAAAAAADEPAGKKAPRGSAAAADA
PHAASMKRGAPAPAELTANVLGHPTPSLSEHYALGRKLGQGQFGTTYLCTDLATGVDYAC
KSIAKRKLITKEDVEDVRREIQIMHHLAGHRNVVAIKGAYEDPQYVHIVMELCAGGELFD
RIIERGQFSERKAAELTRIIVGVIEACHSLGVIHRDLKPENFLLANKDDDLSLKAIDFGL
SVFFKPGQVFTDVVGSPYYVAPEVLRKCYGPEADVWTAGVILYILLSGVPPFWAETQQGI
FDAVLKGVIDFDSDPWPVISDSAKDLIRRMLNPRPKERLTAHEVLCHPWICDHGVAPDRP
LDPAVLSRIKQFSAMNKLKKMALRVIAESLSEEEIAGLKEMFKAMDTDNSGAITYDELKE
GMRKYGSTLKDTEIRDLMEAADVDNSGTIDYIEFIAATLHLNKLEREEHLVAAFSYFDKD
GSGYITVDELQQACKEHNMPDAFLDDVIKEADQDNDGRIDYGEFVAMMTKGNMGVGRRTM
RNSLNISMR
NT seq 1650 nt   +upstreamnt  +downstreamnt
atggggaacacgtgcggcgtcacgcttagatccaagtacttcgccagcttccgcggcgcg
tcgcagcggcatgatgaggcggggtacgcgcccgtcgccaccagcgccgccgccgccgcc
gccgccgatgagccggccgggaagaaggccccgcgcggttctgcggcggcggcggacgcg
ccgcacgccgcgtccatgaagcgcggggcgcccgcgcccgcggagctgacggccaacgtg
ctcgggcacccgaccccgagcctgagcgagcactacgcgctcgggcgcaagctcgggcag
gggcagttcggcaccacctacctctgcaccgacctcgccaccggggtggactacgcctgc
aagtccatagccaagcggaagctcatcaccaaggaggacgtcgaggacgtccgccgcgag
atccagatcatgcaccacctcgcgggccaccggaacgtcgtcgccatcaagggcgcctac
gaggacccgcagtacgttcacattgtgatggagctctgcgccgggggcgagctgttcgac
cgcatcatcgagcgcgggcaattcagcgagcgcaaagcggccgagctcacgcgaatcatc
gttggtgtcatcgaggcgtgccactcgctcggggttatccatagggatctcaagcccgag
aacttcttgctggcgaataaagacgacgatttgtcgctcaaggccatcgatttcggcttg
tctgtgttcttcaagcctggtcaagtttttactgatgttgttggaagcccatactacgtg
gccccagaagtgttgcgtaaatgctacggaccagaagctgatgtttggacagctggtgtg
attctttacatactattaagtggtgtaccgccattttgggcagagacgcagcaagggata
tttgatgcagtgttaaaaggtgtaattgattttgattccgatccctggcctgtgatttct
gatagtgcaaaggatcttataagaagaatgttgaatcctcgccccaaggagcgcctaaca
gctcatgaagttttatgtcatccgtggatttgtgaccatggagtcgctcctgatcgacct
cttgatcctgctgtactttctcgcattaagcagttttcagcaatgaataagttaaagaag
atggctttgcgagtaattgctgaaagcctttcagaggaggagattgcaggattgaaggaa
atgttcaaggcaatggacacagataatagtggtgcaattacatatgatgaactcaaagaa
ggcatgagaaaatatggctcaacactaaaggatactgagattcgtgatcttatggaggcg
gcggatgtggacaacagtggaaccattgattatatagaattcattgctgctactctgcat
ctcaataaactagagcgagaggaacatctagtggcagccttttcttatttcgacaaagat
ggcagtggttatattacggtggatgagcttcagcaagcttgcaaagagcataacatgcca
gatgcttttctcgatgacgtcattaaagaagctgatcaggataatgatggtcgcattgac
tacggggaattcgttgccatgatgacaaagggcaatatgggtgttgggaggagaacaatg
agaaacagcttgaatataagcatgagatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331257
Entry
4331257           CDS       T01015                                 
Name
(RefSeq) calcium-dependent protein kinase 26
  KO
K13412  calcium-dependent protein kinase [EC:2.7.11.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4331257
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:osa01001]
    4331257
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     4331257
Protein kinases [BR:osa01001]
 Serine/threonine kinases: CAMK group
  CDPK family
   4331257
SSDB
Motif
Pfam: Pkinase EF-hand_1 EF-hand_7 EF-hand_6 PK_Tyr_Ser-Thr EF-hand_8 EF-hand_5 EF-hand_4 EF-hand_9 Kdo APH Kinase-like ABC1 tRNA_synt_1c_R1
Other DBs
NCBI-GeneID: 4331257
NCBI-ProteinID: XP_015624615
UniProt: Q6K968
LinkDB
Position
2:35774914..35777288
AA seq 545 aa
MGNYYSCGASSTSSPTSPSLVDYYYCYHRYPSSCSSTSTATSSGGRMPIRSHQQRLSSPT
AVLGHETPALREVYTVGRKLGQGQFGTTYLCTQVSTGAEYACKSIAKRKLLSPEDVEDVR
REIQIMHHLAGHGSVVTIQGAYEDNLYVHIVMELCEGGELFDRIVERGYFSERKAAEITR
VIVGVVEACHSLGVMHRDLKPENFLLKESSSSSSLKAIDFGLSVFFKPGQVFSDVVGSPY
YVAPEVLCKHYGPEADVWTAGVIVYILLSGVPPFWAETQQGIFDAVLRGSLDFDSDPWPT
ISDSAKDLIRRMLRSPPRERLTAHQVLCHPWVCDDGVAPDRPLAPAVLSRLKQFSAMNRL
KKMALRVIARNLSEEELAGLKEMFKAMDTDASGAITFDELKEGLRRYGSNLREAEIRDLM
DAADVDKSGTIDYDEFIAATVHLNKLEREEHLLAAFAYFDRDGSGYITVDELEHACRDHN
MADVGIDDIIREVDQDNDGRIDYGEFVAMMKKGAIDIIGNGRLTIGRPTTATSDDPSPTI
SSSSR
NT seq 1638 nt   +upstreamnt  +downstreamnt
atgggcaactactactcgtgcggcgcctcgtccacgtccagcccgacctcaccgtccttg
gtcgactactactactgctatcatcggtatccaagcagttgcagtagtacaagcacagca
acaagtagcggggggaggatgccgatccgcagccaccagcagaggctgtcgtccccgacg
gcggtgctggggcacgagacgccggcgctgcgggaggtgtacacggtggggcggaagctg
gggcaggggcagttcgggacgacgtacctgtgcacgcaggtgtcgacgggggcggagtac
gcgtgcaagtcgatcgcgaagaggaagctgctgagcccggaggacgtggaggacgtgcgg
cgggagatacagataatgcaccacctggcggggcacgggagcgtggtgaccatccagggc
gcgtacgaggacaacctgtacgtgcacatcgtgatggagctgtgcgagggcggggagctg
ttcgaccgcatcgtggagcgcggctacttctcggagcgcaaggccgcggagatcacgcgc
gtcatcgtcggggtggtggaggcgtgccactccctgggcgtcatgcaccgcgacctcaag
cccgagaacttcctcctcaaggaatcctcctcctcctcctcgctcaaggccatcgacttc
ggcctctccgtcttcttcaagcccgggcaggtgttcagcgacgtggtggggagcccctac
tacgtggcgccggaggtgctgtgcaagcactacggccccgaggcggacgtgtggacggcg
ggcgtcatcgtctacatcctcctcagcggggtgccccccttctgggcggagacgcagcag
ggcatcttcgacgccgtcctccggggatccctcgacttcgactccgacccatggcccacc
atctccgacagcgccaaggacctcatccgccgcatgctccgctccccgcccagggaacgc
ctcaccgcccaccaggtgctttgccacccctgggtctgcgacgacggcgtcgcccccgac
cgccccctcgcccccgccgtcctctcccgcctcaagcagttctccgccatgaacaggctc
aagaagatggcgctgcgtgtcatcgcccggaacctctccgaggaggagctcgctggcctc
aaggagatgttcaaggccatggacaccgacgccagcggcgccatcaccttcgacgagctc
aaggaaggactccgcagatacggctccaacctcagggaggctgagatcagggatctcatg
gacgccgccgacgttgacaaaagcggcaccatcgactacgacgagttcatcgccgccacc
gtccacctcaacaagctggagcgcgaggagcacctgctcgccgccttcgcctacttcgac
cgcgacggcagcggctacatcaccgtcgacgagctcgagcacgcctgcagggaccacaac
atggccgacgttggcatcgacgacatcatccgcgaagtcgaccaagacaacgacggccgc
atcgactacggcgagttcgtcgcaatgatgaagaagggcgctatcgatatcatcggcaac
ggaaggctcaccattggaaggccaactacggctacttccgacgatccttctccaacaatc
tcttcttcctctagatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331490
Entry
4331490           CDS       T01015                                 
Name
(RefSeq) calcium-dependent protein kinase isoform 11
  KO
K13412  calcium-dependent protein kinase [EC:2.7.11.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4331490
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:osa01001]
    4331490
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     4331490
Protein kinases [BR:osa01001]
 Serine/threonine kinases: CAMK group
  CDPK family
   4331490
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_6 EF-hand_5 Kdo EF-hand_4 EF-hand_9 APH Kinase-like tRNA_synt_1c_R1 Pox_ser-thr_kin DUF5580 Fer4_19 CCDC158
Other DBs
NCBI-GeneID: 4331490
NCBI-ProteinID: XP_015631535
UniProt: P53684
LinkDB
Position
3:1624884..1629492
AA seq 542 aa
MGNQCQNGTLGSDYHNRFPREHAVGYVQGDSYLDLKKFDDTWPEVNNFKPTAASILRRGL
DPTSINVLGRKTADLREHYIIGRKLGQGQFGTTYLCTEINTGCEYACKTIPKRKLITKED
VEDVRREIQIMHHLSGHKNVVAIKDVYEDGQAVHIVMELCAGGELFDRIQEKGHYSERKA
AELIRIIVSIVAMCHSLGVMHRDLKPENFLLLDKDDDLSIKAIDFGLSVFFKPGQVFTEL
VGSPYYVAPEVLHKRYGPESDVWSAGVILYVLLSGVPPFWAETQQGIFDAVLKGHIDFQS
DPWPKISDSAKDLIRKMLSHCPSERLKAHEVLRHPWICENGVATDQALDPSVISRLKQFS
AMNKLKKLALRVIAERLSEEEIAGLREMFKAVDTKNRGVITFGELREGLRRFGAEFKDTE
IGDIMEAAHNDNNVTIHYEEFIAATLPLNKIEREEHLLAAFTYFDKDGSGYITVDKLQRA
CGEHNMEDSLLEEIISEVDQNNDGQIDYAEFVAMMQGSNVGLGWQTMESSLNVALRDAPQ
VH
NT seq 1629 nt   +upstreamnt  +downstreamnt
atggggaatcagtgccagaacgggactcttgggagtgattaccacaatcggttcccaagg
gagcatgccgttgggtacgttcagggggatagctacttggacttgaagaagttcgatgat
acttggcctgaggtgaacaacttcaagcctactgctgctagtattctcaggcgggggttg
gatcctacatctatcaatgtccttgggcggaagacagcggacctaagggagcattatatc
attggtcggaagcttggtcagggccagtttggcacaacttacctctgtaccgagatcaat
acagggtgtgagtatgcttgcaagaccatcccaaagcgcaagctcatcaccaaggaggat
gtagaagatgtgcgccgtgagattcagataatgcaccatttgtcgggccacaagaatgtt
gttgcaatcaaggatgtctatgaggatgggcaagcggtgcacattgtgatggagctctgc
gctggtggggagctctttgacaggattcaggagaaggggcattacagcgagcggaaggct
gcagagcttataagaataattgtcagcattgtggctatgtgccattcgctcggggtgatg
caccgtgatcttaagccagaaaatttcctccttttggataaagatgatgatctgtcaata
aaggcaatagattttggtctatccgtgttcttcaaaccaggtcaggttttcactgagctg
gttgggagtccatattatgttgctcctgaggtattgcacaaacgttatggaccagaatct
gatgtgtggtcagctggagtgatactttacgttttgctgagtggagtgccaccattttgg
gcagagacacaacaaggaatatttgatgcagttctgaagggtcacattgattttcaatct
gatccatggccaaagatatctgacagtgcaaaggatcttataagaaaaatgctctctcat
tgcccttcggagcgtttgaaggcccatgaagtgctaaggcatccttggatctgtgaaaat
ggagttgccactgatcaagctctggatcccagtgttatctctcggctcaaacaattctct
gcaatgaacaagttaaagaagttggctctgagagtgatagctgagcgtctttcagaggag
gagattgctgggttaagagaaatgttcaaggcagtggacacaaaaaatagaggtgtaatc
actttcggtgagcttagagaaggtttaagaagatttggcgctgaatttaaggatacagag
attggtgatataatggaagcggcacacaacgacaataatgtaacaatccattatgaagaa
tttattgctgcaactctacctcttaacaagatagaacgtgaggagcacctgctggcagct
tttacatattttgacaaagatgggagtggttatatcacagttgacaagcttcaacgagct
tgtggagaacataacatggaggattcactccttgaagagattatttcagaggttgatcaa
aacaatgacggccaaattgactacgccgaatttgtagccatgatgcaaggcagcaacgtt
ggactagggtggcaaacaatggaaagcagtttgaatgtagcattaagagacgcacctcaa
gtacattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333767
Entry
4333767           CDS       T01015                                 
Name
(RefSeq) calcium-dependent protein kinase 10
  KO
K13412  calcium-dependent protein kinase [EC:2.7.11.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4333767
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:osa01001]
    4333767
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     4333767
Protein kinases [BR:osa01001]
 Serine/threonine kinases: CAMK group
  CDPK family
   4333767
SSDB
Motif
Pfam: Pkinase EF-hand_1 EF-hand_7 PK_Tyr_Ser-Thr EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_4 Kdo EF-hand_9 ABC1 SPARC_Ca_bdg APH
Other DBs
NCBI-GeneID: 4333767
NCBI-ProteinID: XP_015631324
UniProt: Q6AVI8
LinkDB
Position
3:27466946..27472772
AA seq 574 aa
MGNTCCVAPATTDEVGAPPRDHHHAAKKSPAPSATTTTATRQRHGQEPKPKPKPRARAKP
NPYDWAPPRVLPARGGAAASAVRVLEGVVPHHPRLRVTDKYQLGRELGRGEFGVTHLATD
RATRERLACKSIPKRRLRTAVDVADVRREVAIMASLPDHPALVRLRAAYEDADAVHLVME
LCDGGELFDRIVARGRYTERAAAAAARTVAEVVRACHAHGVMHRDLKPENFLYAGKAEDA
QLKAIDFGLSVFFRPGERFREIVGSPYYMAPEVLRRDYGPEVDIWSAGVILYILLCGVPP
FWAETEQGVARAILRGAADFDREPWPRISRAAKSLVRQMLDVDPRRRPTAQQVLDHPWLH
HAARAPNVPLGDVVRARLKQFSLMNRLKKKAMRVIAEHLSVEEVEVIKDMFALMDTDNNG
RVTLQELKDGLTKVGSKLAEPEMELLMEAADVDGNGYLDYGEFVAVTIHLQRLSNDNHLR
TAFLFFDKDGSGYIDRAELADALADDSGHADDAVLDHILREVDTDKDGRISYEEFVAMMK
SGTDWRKASRQYSRERFKTLSNSLIKDGSITMAR
NT seq 1725 nt   +upstreamnt  +downstreamnt
atgggcaacacgtgctgcgtcgctccggctaccaccgatgaggtgggcgcgccgccgcga
gatcatcatcacgcggccaagaagtcgccggcgccgtcggcgacgacgacgacggcgacg
aggcagaggcatggccaagaacccaagcccaagcccaagcccagggcgagggcgaagccc
aacccgtacgactgggcgccgccgcgggtgctgccggcgaggggcggcgccgccgcgtcc
gcggtgcgcgtgctggagggcgtggtgccgcaccacccgcggctgcgcgtcacggacaag
taccagctcggccgcgagctggggcgcggcgagttcggggtgacgcacctcgccacggac
cgcgcgacgcgggagcggctggcgtgcaagtccatcccgaagcgccgcctccgcaccgcc
gtggacgtcgccgacgtgcggcgcgaggtggccatcatggcgtcgctcccggaccacccg
gcgctggtgcgcctccgcgccgcctacgaggacgccgacgcggtgcacctggtgatggag
ctctgcgacggcggcgagctgttcgaccggatcgtggcgaggggccggtacacggagcgc
gccgcggccgccgcggcgcggacggtggcggaggtggtgcgcgcgtgccacgcccacggc
gtgatgcaccgcgacctcaagccggagaacttcctctacgccggcaaggccgaggacgcg
cagctcaaggccatcgatttcggcctctccgtcttcttccgacctggggagaggttcagg
gagatcgtggggagcccgtactacatggcgccggaggtgctccggcgagactacggcccg
gaggtggacatctggtccgccggcgtcatcctctacatcctcctgtgcggcgtcccgccg
ttctgggccgagacggagcagggcgtggcgcgcgccatcctccgcggcgccgccgacttc
gaccgggagccatggccgcgcatctcccgcgccgccaagtccctcgtccgccagatgctc
gacgtggacccgcgccgccgccccacggcgcagcaggtgctcgaccacccctggctccac
cacgccgcccgcgcccccaacgtccccctcggcgacgtcgtccgcgcccgcctcaagcag
ttctccctcatgaaccgcctcaagaagaaggccatgcgggtgatcgcggaacacctgtcg
gtagaggaggtggaggtgatcaaggacatgttcgcgctcatggacaccgacaacaacggc
agggtcacgctccaggagctcaaggacggcctcaccaaggtcggctccaagctcgccgag
cccgagatggagcttctcatggaggccgcggatgtggatggcaatgggtacctggactac
ggcgagttcgtggcggtgaccatccacctgcagcgcctctccaacgacaaccacctccgc
acggccttcctcttcttcgacaaggacggcagcggctacatcgaccgcgccgagctcgcc
gacgccctcgccgacgactccggccacgccgacgacgccgtgctcgaccacatccttaga
gaagtcgacaccgacaaggatgggcggatcagctacgaggagttcgtggcgatgatgaaa
tccgggacggattggaggaaggcgtcgcggcaatactcgagggagcggttcaagacgctc
agcaacagcctcatcaaggacggctcgatcaccatggcgcgctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334371
Entry
4334371           CDS       T01015                                 
Name
(RefSeq) calcium-dependent protein kinase 26
  KO
K13412  calcium-dependent protein kinase [EC:2.7.11.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4334371
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:osa01001]
    4334371
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     4334371
Protein kinases [BR:osa01001]
 Serine/threonine kinases: CAMK group
  CDPK family
   4334371
SSDB
Motif
Pfam: Pkinase EF-hand_1 EF-hand_7 PK_Tyr_Ser-Thr EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_4 Kdo SPARC_Ca_bdg EF-hand_9 Kinase-like tRNA_synt_1c_R1 DUF3215
Other DBs
NCBI-GeneID: 4334371
NCBI-ProteinID: XP_015629654
UniProt: Q852N6
LinkDB
Position
3:complement(32790551..32795140)
AA seq 576 aa
MGNNCVGPSAAGQNGFFANVALWRPRPADAAPPALPPPSSAPSDQAPEPVTIPPSEHSSH
HSSRSTDPSTPTSAAEQPANKAAPKVKRVQSAGLLADSVLKRDVNTARLKDLYTIGKKLG
QGQFGTTYLCVEKATGREFACKSIAKRKLLTQEDVEDVRREIQIMHHLAGHANVVSIVGA
YEDAVAVQLVMELCAGGELFDRIIQRGHYSEKAAAQLARVIVGVIEACHSLGVMHRDLKP
ENFLFIHQKEDSPLKAIDFGLSIFFKPGETFTDVVGSPYYVAPEVLMKHYGREVDVWSAG
VIIYILLSGVPPFWDESEQGIFEQVLKGDLDFSSEPWPNISESAKDLVRKMLIRDPKKRL
TAHEALCHPWVCVDGVAPDKPLDSAVLSRLKQFSAMNKLKKMALRVIAESLSEEEIAGLK
EMFKMLDTDNSGHITLEELKTGLQRVGANLMDSEIDALMEAADIDNSGTIDYGEFIAATL
HINKVEKEDKLFAAFSYFDKDGSGYITQDELQKACEEFGIGDTRIEDIIGDIDQDNDGRI
DYNEFVEMMQKGNNAMGKMGQHSTGNFGLGEALKLR
NT seq 1731 nt   +upstreamnt  +downstreamnt
atgggcaacaactgcgtcggccccagcgccgccggccagaacgggttcttcgccaacgtc
gccctctggcgacccaggcccgccgacgcggctccccccgccctcccgccgccctcctcc
gcgccgtccgaccaggcgcccgagcccgtcacaatccccccatcggagcactcctcccac
cactcctcccgctccaccgacccgtcgacccccacctccgccgcggagcagccggcgaac
aaggcggcgcccaaggtcaagcgcgtccagagcgccgggctgctcgccgattccgtcctc
aagcgcgacgtcaacaccgcccgcctcaaggatctatacacgatcgggaagaagctaggg
caggggcagttcggcaccacctacctctgcgtcgagaaggccacaggtcgggagttcgcc
tgcaagtccatcgccaagaggaagctgctcacgcaggaggacgtcgaggacgtgcgccgc
gagatccagatcatgcaccacctcgcgggccacgccaacgtcgtctccatcgtcggggcc
tacgaggacgccgtcgcggtgcagctcgtcatggagctctgcgccggcggggagctgttc
gacaggatcatccagagggggcattactccgagaaggccgcggcgcagctcgcgcgggtg
atcgtcggcgtcatcgaggcgtgccactccctcggcgtgatgcacagggatctcaagccg
gagaatttcctcttcatccaccagaaggaggattcgcctctcaaggccatcgatttcggc
ctctccatcttcttcaagccaggtgagacatttacggatgttgttggaagcccgtactat
gttgcacctgaggttcttatgaaacattatggtcgtgaggttgacgtctggagtgctggt
gtgataatctacattttgttgagtggggttcctccattttgggatgaaagtgagcaaggg
atatttgaacaagttttgaaaggtgatctggacttctcatctgagccttggcctaatatc
tcagagagcgcaaaggatttggtcagaaaaatgcttattcgtgatccaaaaaagagattg
actgcccatgaagccctatgtcatccttgggtctgtgttgatggagttgctcctgacaag
cctcttgattccgctgtcttgagtcggttaaaacaattttctgcaatgaacaaactaaag
aaaatggcgcttagggttattgctgagagtttatcagaagaagaaattgcaggattaaaa
gagatgttcaaaatgctagacactgacaacagcggtcatattacactggaagaactaaaa
acaggcttgcagagagttggtgctaatttgatggactcggaaattgatgctctaatggag
gcagcagatattgacaacagcggaacaattgattatggagaattcattgctgcaactttg
catataaacaaagtagagaaggaggataagctgtttgcagctttctcatactttgataaa
gatggcagcggttacattactcaagatgagcttcaaaaggcatgtgaggaattcggtata
ggtgatacccgtattgaggatattattggagacattgatcaggacaatgatggacggatc
gactacaatgagtttgtcgaaatgatgcagaagggaaataatgcaatgggtaaaatgggt
cagcatagtaccggaaactttggcctcggggaagcgctaaaacttcggtaa

DBGET integrated database retrieval system