KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276353
Entry
107276353         CDS       T01015                                 
Name
(RefSeq) hypoxanthine-guanine phosphoribosyltransferase-like
  KO
K00760  hypoxanthine phosphoribosyltransferase [EC:2.4.2.8]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107276353
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.8  hypoxanthine phosphoribosyltransferase
     107276353
SSDB
Motif
Pfam: Pribosyltran DUF5678 UPRTase PRTase_2 RskA zf-CHC2
Other DBs
NCBI-GeneID: 107276353
NCBI-ProteinID: XP_015637816
UniProt: A0A0P0WIZ3
LinkDB
Position
5:complement(4947692..4951908)
AA seq 261 aa
MQNLGIPPFLPAGPATAPFHSRKTSSPPPPPPPSPPATNKSPNPARPRRPRRRGTLTLAL
PAAAMVGGGAGADAGIDRVLWTEAEIAARVSEVAAELAADLRALREPAVVVGVATGAFLF
LADLVRRVDAPLAVDLVRAESYGDGTESSGRPRITSDLKVDVAGKHVVVVEDIVDTGNTV
SCLIAYLEKKGASSISVCTFLDKPARRTANFQLVGDGKFYRGFECPDSFVVGYGMDYAEL
YRNLPYVGVLKAEMYKKDTSN
NT seq 786 nt   +upstreamnt  +downstreamnt
atgcagaatttgggaatcccaccattcctccccgctggccccgccaccgcccctttccat
tcgcggaaaacctcctctcctcctcctcctcctcctccgtctccgcccgccaccaataaa
tcccccaatcccgcgcgcccccgccgcccccgccgccgcggaaccctaaccctagctctc
cccgccgccgcgatggtgggcggcggcgccggcgcagacgccggcatcgaccgggtgctg
tggacggaggccgagatcgccgcccgggtgtcggaggtggccgccgagctcgccgccgac
ctccgcgccctgcgcgagcccgccgtcgtcgtcggcgtcgccacgggggcgttcctcttc
ctcgccgacctggtccgccgcgtcgacgcgccgctcgccgtggacctcgtgcgcgccgag
tcgtacggcgacggcaccgagtccagcggccggccgcggatcacctccgacctcaaagtc
gacgtcgccgggaagcacgtcgtggtggtggaagatattgtggacactgggaatactgtt
tcctgtcttattgcttatttagaaaagaaaggagcatcatccatatcagtctgcactttt
cttgacaaaccggcaaggagaactgctaattttcagctagtgggggatggaaaattttat
agaggttttgagtgcccagattcctttgttgttggatatggcatggattatgctgaactc
taccgcaacctgccttatgttggagttcttaaggccgagatgtacaaaaaagatacaagc
aattag

DBGET integrated database retrieval system