KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107277317
Entry
107277317         CDS       T01015                                 
Name
(RefSeq) ubiquitin-60S ribosomal protein L40-like
  KO
K02927  ubiquitin-large subunit ribosomal protein L40e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    107277317
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107277317
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    107277317
   04121 Ubiquitin system [BR:osa04121]
    107277317
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    107277317
  Archaea
    107277317
Ubiquitin system [BR:osa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   107277317
SSDB
Motif
Pfam: Ribosomal_L40e ubiquitin Rad60-SLD Ubiquitin_2 DUF2604
Other DBs
NCBI-GeneID: 107277317
NCBI-ProteinID: XP_015647252
LinkDB
Position
7:18350939..18410530
AA seq 135 aa
MQIFVRTLDECITLEVEGSDTIGDVKVKIHDKNGIPADDQRLMHAGRQLDDRRTLADYGI
QKESTLHLAVRLRGGSRGHYPCLAPGLLALARKYIEMKMICRKCYARLPPRSTNCRKKKC
GHSNKLRRKKKLKDY
NT seq 408 nt   +upstreamnt  +downstreamnt
atgcagatcttcgtgaggacgctggacgagtgcatcacgctggaggtcgagggcagcgac
accatcggcgacgtcaaggtcaagatccacgacaagaacggcatcccggcggacgaccag
cggctgatgcacgccgggaggcagctggatgatcgacggacgctggccgactacggcatc
cagaaggagtccacgctccacctcgccgtccgcctccgcggcggcagccgcggccactat
ccctgcctcgctcccggcctcctcgccctcgcgcgcaagtacatcgagatgaagatgatc
tgccgcaagtgctatgcacgccttccccccaggtctacaaactgccgcaagaagaagtgt
ggtcacagcaacaagctaaggcgtaagaaaaagttaaaggactactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332169
Entry
4332169           CDS       T01015                                 
Name
(RefSeq) ubiquitin-60S ribosomal protein L40-2
  KO
K02927  ubiquitin-large subunit ribosomal protein L40e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4332169
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4332169
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4332169
   04121 Ubiquitin system [BR:osa04121]
    4332169
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4332169
  Archaea
    4332169
Ubiquitin system [BR:osa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   4332169
SSDB
Motif
Pfam: ubiquitin Ribosomal_L40e Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 zf-C4pol Ubiquitin_5 Dsc3_N DUF2604
Other DBs
NCBI-GeneID: 4332169
NCBI-ProteinID: XP_015629795
UniProt: P0CH34 P0CH35
LinkDB
Position
3:complement(7102156..7104769)
AA seq 129 aa
MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
IQKESTLHLVLRLRGGIIEPSLQALARKYNQDKMICRKCYARLHPRAVNCRKKKCGHSNQ
LRPKKKIKN
NT seq 390 nt   +upstreamnt  +downstreamnt
atgcaaatcttcgtgaagaccctgactgggaagaccatcaccctcgaggtggagagcagc
gacaccatcgacaatgtcaaggctaagatccaggacaaggagggaatcccgccggaccag
cagcggctgatcttcgccgggaagcagctggaggacggacgcaccctggctgactacaac
atccagaaggagtccaccctccacctcgtcctcaggctccgtggcggtatcatcgagccg
tcgcttcaggcgcttgcccgcaagtacaaccaggacaagatgatctgccgcaaatgctat
gcgcgcctgcaccctagggctgtcaactgccgcaagaagaagtgtggtcacagcaaccag
ctgaggcccaagaagaagatcaagaactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332312
Entry
4332312           CDS       T01015                                 
Name
(RefSeq) ubiquitin
  KO
K02927  ubiquitin-large subunit ribosomal protein L40e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4332312
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4332312
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4332312
   04121 Ubiquitin system [BR:osa04121]
    4332312
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4332312
  Archaea
    4332312
Ubiquitin system [BR:osa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   4332312
SSDB
Motif
Pfam: ubiquitin Ribosomal_L40e Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 Ubiquitin_5 Dsc3_N
Other DBs
NCBI-GeneID: 4332312
NCBI-ProteinID: XP_015630915
UniProt: A0A5S6R6S5
LinkDB
Position
3:8409925..8412096
AA seq 136 aa
MQIFVKTLTGKTITLEVENSDAVANVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
IQKESTLHLVLRLRGGHIWIEPSLRVLAYKHNINKMVCRKCYATLPPRATNCRKKKCGHS
NQLRPKKVRWCRYFNF
NT seq 411 nt   +upstreamnt  +downstreamnt
atgcagatcttcgtgaagacgctgacggggaagaccatcaccctcgaggtggagaacagc
gacgccgtcgccaacgtcaaggccaagatccaggacaaggaaggtatcccgccggaccag
cagcgcctcatcttcgccgggaagcagctggaggatggccgcacgctggccgactacaac
atccagaaggagtccacgcttcacctggtgcttcgcctacgcggcggccacatctggatc
gagccctcgctcagggtcctcgcctacaagcacaacatcaacaagatggtctgcaggaag
tgctatgcaactctgcctcccagggctacaaactgccgcaagaagaagtgtggccacagc
aatcagctgaggccaaagaaggtgaggtggtgcaggtacttcaacttctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343261
Entry
4343261           CDS       T01015                                 
Name
(RefSeq) ubiquitin
  KO
K02927  ubiquitin-large subunit ribosomal protein L40e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4343261
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4343261
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4343261
   04121 Ubiquitin system [BR:osa04121]
    4343261
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4343261
  Archaea
    4343261
Ubiquitin system [BR:osa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   4343261
SSDB
Motif
Pfam: ubiquitin Ribosomal_L40e Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 Ubiquitin_5 CFAP298 Dsc3_N DUF2604
Other DBs
NCBI-GeneID: 4343261
NCBI-ProteinID: XP_015646154
UniProt: A3BJV9
LinkDB
Position
7:complement(18133357..18135395)
AA seq 139 aa
MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
IQKESTLHLVLRLRGGGRPGYPMIEPNLLALARSKMEKKMICRKCYARLPYKATNCRKKK
CGHTNELRPKKKLVSKLSV
NT seq 420 nt   +upstreamnt  +downstreamnt
atgcagatcttcgtgaagaccctgacggggaagaccatcaccctcgaggtcgagagcagc
gacaccatcgacaatgtcaaggccaagatccaggacaaggaagggatcccgccggaccag
cagcggctgatcttcgccgggaagcagctggaggacggccggacgctggccgactacaac
atccagaaggagtcgacgctgcacctcgtgcttcgcctccgcggcggcggccgcccgggc
tacccgatgatcgagcccaacctcctcgccctcgcccgcagcaagatggagaagaagatg
atctgccgcaagtgctacgcgcgccttccctacaaggctaccaactgtcgcaagaagaaa
tgcggccacaccaacgagctgaggccaaagaagaagctggtatccaagctttctgtttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347232
Entry
4347232           CDS       T01015                                 
Name
(RefSeq) ubiquitin
  KO
K02927  ubiquitin-large subunit ribosomal protein L40e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4347232
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4347232
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4347232
   04121 Ubiquitin system [BR:osa04121]
    4347232
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4347232
  Archaea
    4347232
Ubiquitin system [BR:osa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   4347232
SSDB
Motif
Pfam: ubiquitin Ribosomal_L40e Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 Ubiquitin_5 zf-C4pol Dsc3_N DUF2604
Other DBs
NCBI-GeneID: 4347232
NCBI-ProteinID: XP_015612663
UniProt: A0A0N7KQX0
LinkDB
Position
9:16973676..16975664
AA seq 140 aa
MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
IQKESTLHLVLRLRGGSRGGYPKGIEPNLRELAQKYNENKLVCRRCYARLPLRSTNCRKK
KCGHSNEIRAKKRFMSKLSK
NT seq 423 nt   +upstreamnt  +downstreamnt
atgcagatcttcgtgaagacgctcaccgggaagacgatcacgctggaggtggagagcagc
gacaccatcgacaacgtcaaggccaagatccaggacaaggaaggtatcccgccggaccag
cagcgtctcatcttcgcggggaagcagctcgaggatggccgcaccctggccgactacaac
attcagaaggagtcgacgcttcacctggtgctccgcctccgcggtggcagcaggggcggc
taccccaaggggatcgagcccaacctccgcgagctcgcgcagaagtacaacgagaacaag
ctggtttgccgcaggtgctatgcacgccttcccctcaggtccaccaactgccgcaagaag
aagtgtggccacagcaatgagataagggcaaagaagaggtttatgtccaagctttcgaag
tga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347409
Entry
4347409           CDS       T01015                                 
Name
(RefSeq) ubiquitin
  KO
K02927  ubiquitin-large subunit ribosomal protein L40e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4347409
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4347409
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4347409
   04121 Ubiquitin system [BR:osa04121]
    4347409
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4347409
  Archaea
    4347409
Ubiquitin system [BR:osa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   4347409
SSDB
Motif
Pfam: ubiquitin Ribosomal_L40e Rad60-SLD Ubiquitin_2 TBK1_ULD Ubiquitin_5 Rad60-SLD_2 Dsc3_N DUF2604
Other DBs
NCBI-GeneID: 4347409
NCBI-ProteinID: XP_015611924
UniProt: Q0J0U4
LinkDB
Position
9
AA seq 139 aa
MQIFVKTLTGKSITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
IQKESTLHLVLRLRGGSRGGYTIQEPSLLLLALKYNEKKMVCRKCYARLPARSTNCRKKK
CGHTNQIRPKKRFISKTAN
NT seq 420 nt   +upstreamnt  +downstreamnt
atgcagatcttcgtgaagacgctgacggggaagtcgatcacgctggaggtggagagcagc
gacaccatcgacaacgtcaaggccaagatccaggacaaggaaggtatccctccggaccag
cagcgcctcatcttcgcggggaagcagctggaggatggccgcaccctggccgactacaac
atccagaaggagtcgacgctgcacctggtgctccgcctccgcggcggcagcaggggcggc
tacaccatccaggagcccagcctcctgctcctggcgctcaagtacaacgagaagaagatg
gtctgccgcaagtgctacgcacgccttcccgccaggtctaccaactgccgcaagaagaag
tgtggccacaccaaccagataaggccaaagaagaggtttatatccaagactgccaactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347411
Entry
4347411           CDS       T01015                                 
Name
(RefSeq) ubiquitin-60S ribosomal protein L40
  KO
K02927  ubiquitin-large subunit ribosomal protein L40e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4347411
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4347411
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4347411
   04121 Ubiquitin system [BR:osa04121]
    4347411
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4347411
  Archaea
    4347411
Ubiquitin system [BR:osa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   4347411
SSDB
Motif
Pfam: ubiquitin Ribosomal_L40e Rad60-SLD Ubiquitin_2 DUF2604 TBK1_ULD Sde2_N_Ubi Ubiquitin_5 Rad60-SLD_2 Dsc3_N DZR_2 DHHC
Other DBs
NCBI-GeneID: 4347411
NCBI-ProteinID: XP_015611922
LinkDB
Position
9:18664097..18671724
AA seq 190 aa
MGYFAFVAAAFPRPYIRAGDHDCGAAHHSTTTTTTPPIGESAGRSFDGGKMQIFVKTLTG
KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLDDGRTLADYNIQKESTLHLV
LRLRGGSRGGYTIQEPTLRALALKYREKKKVCRKCYARLPIRSHHCRKKKCGHSKELRLK
KKFINSLSIA
NT seq 573 nt   +upstreamnt  +downstreamnt
atgggatatttcgctttcgtggcggctgcgtttcctcgcccatatataagagcgggtgac
cacgactgcggcgcggcgcaccactccaccaccaccaccaccactccaccgatcggcgag
agcgcggggagatcgttcgacggcggcaagatgcagatcttcgtgaagacgctgacgggg
aagacgatcacgctggaggtggagagcagcgacaccatcgacaacgtcaaggccaagatc
caggacaaggaaggtatcccgccggaccagcagcgcctcatcttcgccgggaagcagctg
gatgacggccgcaccctggccgactacaacatccagaaggagtcgacgctgcacctggtg
ctccgcctccgcggcggcagcaggggcggctacaccatccaggagcccaccctccgggct
cttgcgctcaagtacagagagaagaagaaggtctgccgcaagtgctatgcacgccttccc
atcaggtctcaccactgccgcaagaagaagtgtggccacagcaaggagctgaggttgaag
aagaagttcatcaactcgctttcgatagcgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347896
Entry
4347896           CDS       T01015                                 
Name
(RefSeq) ubiquitin-60S ribosomal protein L40-2
  KO
K02927  ubiquitin-large subunit ribosomal protein L40e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4347896
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4347896
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4347896
   04121 Ubiquitin system [BR:osa04121]
    4347896
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4347896
  Archaea
    4347896
Ubiquitin system [BR:osa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   4347896
SSDB
Motif
Pfam: ubiquitin Ribosomal_L40e Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 zf-C4pol Ubiquitin_5 Dsc3_N DUF2604
Other DBs
NCBI-GeneID: 4347896
NCBI-ProteinID: XP_015651280
UniProt: P0CH34 P0CH35
LinkDB
Position
9:22692664..22694815
AA seq 129 aa
MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
IQKESTLHLVLRLRGGIIEPSLQALARKYNQDKMICRKCYARLHPRAVNCRKKKCGHSNQ
LRPKKKIKN
NT seq 390 nt   +upstreamnt  +downstreamnt
atgcagatcttcgtgaagaccctaacggggaagaccatcacgctcgaggtcgagagcagc
gacaccatcgacaatgtcaaggccaagatccaggacaaggaaggcatccctccggaccag
cagcgcctcatcttcgccggcaagcagctggaggatggccgcaccctggccgactacaac
atccagaaggagtccacgctccacctcgtcctccgcctccgcggtggcatcatcgagccc
tccctccaggccctcgcccgcaagtacaatcaggacaagatgatctgccgcaagtgctat
gctcggctgcaccccagggctgtcaactgccgcaagaagaagtgcggccacagcaaccag
ctgaggcccaagaagaagatcaagaactag

DBGET integrated database retrieval system